Property Summary

NCBI Gene PubMed Count 113
PubMed Score 403.71
PubTator Score 52.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 3.3e-04
astrocytoma 1.100 2.8e-03
breast carcinoma 1.200 2.9e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
pediatric high grade glioma 1.300 1.5e-03
pilocytic astrocytoma 1.200 3.4e-03
ovarian cancer 2.700 1.4e-05

Protein-protein Interaction (8)

Gene RIF (67)

PMID Text
26541268 show that the maturation of Mtb-containing autophagosomes into autolysosomes required recruitment of the late endosome marker RAB7, forming the intermediate compartment amphisomes
26348397 Data indicate that the secretion of microRNA miR-143, depends on rab GTP-binding proteins Rab7a and Rab27b.
26038114 We validated ANKRD13A as a novel constituent of BCR signalosome and showed that BCR-induced phosphorylation of RAB7A at S72 regulates its association with its effector proteins and with endo-lysosomal compartments.
25770103 Hepatitis B virus can regulate its own secretion through an activation of the endo-lysosomal and autophagic pathway mediated by Rab7 activation.
25566515 Bacteria controled the localization or function of host Rab5 and Rab7, and therefore modify the maturation from early to late phagosomes.[review]
25565581 regulates hepatocyte lipid droplet catabolism
25496667 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25367362 provides molecular insights into the essential role of Vps26 and Vps35 in Rab7-mediated recruitment of the core retromer complex
25180605 LKB1 promotes RAB7-mediated neuropilin-1 degradation to inhibit angiogenesis
25080504 Regulation of Rab7 activity by mutant LRRK2 in Parkinson's disease impairs membrane trafficking at very late stages of the endocytic pathway.
24920821 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24521780 This study developed the animal model of CMT2B, modelling one of the mutations (L129F) in Drosophila melanogaster. Behavioural assays show that this model recapitulates several hallmarks of the human disease.
24505328 Taken together, these results suggested that Rab7 acts as a negative regulator of prostate tumor growth and invasion, providing further evidence for its potential as a tumor suppressor.
24498653 Implicating the importance of this region for RAB7 protein.
24173214 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23874603 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23733193 Data indicate that Rab5, Rab7 and Rab11 are involved in RGS4 traffics through plasma membrane recycling or endosome.
23562278 Rab7 regulation in autophagy requires endogenous Armus and the activation profiles of Rac1 and Rab7 inversely correlate during starvatio in keratinocytes.
23536683 HBV infection strongly depends on host Rab5 and Rab7 expression.
23188822 results demonstrate that Rab7 CMT2B mutants impair growth factor receptor trafficking and, in turn, alter p38 and ERK1/2 signaling from perinuclear, clustered signaling endosomes
23179371 interaction between disease-causing RAB7A mutants and peripherin could play an important role in Charcot-Marie-Tooth type 2B neuropathy
22673115 This study found that significant evidence of association with RAB7 (VEGAS p = 0.018) in patient with Alzheimer disease.
22638108 Data indicate that Rab7 siRNA knockdown causes increased E-cadherin.
22496312 Inhibition of endosomal maturation-with siRNAs or dominant negative mutants targeting Rab5 and Rab7-inhibited infection and prevented release of Echovirus 7 RNA into the cell.
22115783 the tail-domain of phafin1 provides lysosomal targeting signature and the ability to induce autophagy that is mediated by Rab7 signaling.
22072966 results suggest that Rab7A contributes to the mechanism by which Vpu counteracts the restriction factor BST2/Tetherin and rescues HIV-1 release; results highlight new roles for a major regulator of the late endocytic pathway, Rab7A, in the late stages of the HIV-1 replication cycle
22072966 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21669283 Upregulated expresssion of rab4, rab5, rab7, and rab27 correlates with antemortem measures of cognitive decline in individuals with mild cognitive impariment and Alzheimer disease.
21438969 Results suggest that Rab7 may play a role in secretory lysosome movement toward the centrosome by interacting with RILP to recruit the minus-end motor, dynein.
20974968 Rubicon serves as a previously unknown Rab7 effector to ensure the proper progression of the endocytic pathway.
20847427 Results indicate selective upregulation of Both rab5 and rab7 levels within basal forebrain, frontal cortex, and hippocampus in mild cognitive impairment and Alzheimer's disease.
20709679 Mutations in LITAF, RAB7, LMNA, and MTMR2 genes are rare in Chinese Charcot-Marie-Tooth disease (CMT) patients.
20472552 Rab5 and Rab7, were associated with the pathway of autophagosome formation and the fate of intracellular group A streptococcus.
20459747 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20363736 although only TBC1D15/Rab7-GAP altered Rab7-GTP levels, both Rab7-GAP and mVps39 regulate lysosomal morphology and play a role in maintaining growth factor dependence
20028791 Disease mutations uncouple Rab7 from the spatial and temporal control normally imposed by regulatory proteins and cause disease not by a gain of novel toxic function, but by misregulation of native Rab7 activity.
20012524 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19956673 mechanisms of GAS-containing autophagosome-like vacuoles formation includes not only the common machinery of autophagy, but also Rab7 as an additional component, which is dispensable in canonical autophagosome formation.
19651702 Observational study of gene-disease association. (HuGE Navigator)
19620308 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19580780 These results suggest that the dissociation of Rab7 from M.tb phagosome is the important process in inhibition of phagolysosome biogenesis.
19564404 Results describe how ORP1L contacts VAP to control Rab7-RILP-p150 Glued and late endosome positioning.
19451649 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19392663 the central role of Rab7 in endosomal traffic and summarize the studies focusing on the participation of Rab7 in disease pathogenesis.
19372461 Rab GTPase regulation of VEGFR2 trafficking and signaling in endothelial cells; Endothelial cell migration was increased by Rab5a depletion but decreased by Rab7a depletion
18974300 Data suggest that translocation of ATP7B takes place independently of Rab7-regulated endosomal traffic, and that Murr1 plays a role in a later step of the copper excretion pathway but is not involved in the translocation of the Wilson disease protein.
18955491 cholesterol accumulation can have a detrimental effect on phagosome maturation by impairing the activation of Rab7
18501189 The biochemical and functional properties of the Rab7 K157N mutated protein were investigated.
18272684 All tested CMT2B-associated Rab7 mutations are mechanistically similar, suggesting that activated forms of the Rab7 are responsible for CMT2B disease.
18039930 RIDalpha coordinates recruitment of these GTP-Rab7 effectors to compartments that would ordinarily be perceived as early endosomes, thereby promoting the degradation of selected cargo.
17625594 GTP-bound form of Rab7 promotes melanogenesis through the regulation of gp100 maturation in melanoma cells.
16965270 Rab7 controls microtubule-mediated transport of early and Rab27a the subsequent actin-dependent transport of mature melanosomes.
16631113 Hence, RILPsv provides an extra dimension to the control of vesicle fusion and transport by the small GTPase Rab7.
16282324 rab7 regulates the endocytic trafficking of the EGF.EGFR complex by regulating its lysosomal degradation
16176980 ORP1L binds to Rab7, modifies its functional cycle, and can interfere with lysosome organization and endocytic membrane trafficking.
15996637 The data together indicate that RILP, as already demonstrated for several other Rab effector proteins, is capable of self-association, thus probably forming a homo-dimer.
15933719 The crystal structure of Rab7-GTP in complex with the Rab7 binding domain of RILP reveals that Rab7 interacts with RILP specifically via two distinct areas.
15681833 ATP7B resides in the late endosomes with Rab7 and the Niemann-Pick C1 protein and translocates copper from the cytosol to the late endosomal lumen, participating in biliary copper excretion via lysosomes
15455439 This study report a family with autosomal dominant ulcero-mutilating neuropathy and Sequencing the RAB7 gene showed a novel heterozygous A to C mutation, changing asparagine to threonine at codon 161.
15340014 Results show a role for Rab7 in the final maturation of late autophagic vacuoles.
15186776 Rab7 interacts with the Rab binding platform of REP-1 via an extended interface involving the Switch 1 and 2 regions.
15099588 All patients presented with a symmetric motor and sensory neuropathy, which was more pronounced in the lower limbs. Further, distal muscle wasting and impaired deep tendon reflexes were found.and linkage to chromosome 19q13.3.
14644159 increase in the concentration of copper in the medium (189 microM) rapidly induces a redistribution of the MNK protein from early sorting endosomes, positive for Rab5-myc protein, to late endosomes, containing the Rab7-myc protein
12850305 Not a new major locus for Japanese oculocutaneous albinisms.
12545426 Mutations in this protein cause Charcot-Marie-Tooth type 2B neuropathy.
12054610 may be involved in the process of atherogenesis
12034881 an endocytotic catalyst, a tandem regulator of thyroid hormone production

AA Sequence

MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF      1 - 70
QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ     71 - 140
AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC       141 - 207
//

Text Mined References (122)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26911690 2016 Parkin Modulates Endosomal Organization and Function of the Endo-Lysosomal Pathway.
26541268 2015 Mycobacterium tuberculosis Inhibits RAB7 Recruitment to Selectively Modulate Autophagy Flux in Macrophages.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26348397 2015 Rab7a and Rab27b control secretion of endothelial microRNA through extracellular vesicles.
26038114 2015 Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25770103 2015 HBV secretion is regulated through the activation of endocytic and autophagic compartments mediated by Rab7 stimulation.
25566515 2014 The complexity of Rab5 to Rab7 transition guarantees specificity of pathogen subversion mechanisms.
25565581 2015 The small GTPase Rab7 as a central regulator of hepatocellular lipophagy.
25367362 2015 Molecular insights into Rab7-mediated endosomal recruitment of core retromer: deciphering the role of Vps26 and Vps35.
25180605 2014 Protein kinase LKB1 promotes RAB7-mediated neuropilin-1 degradation to inhibit angiogenesis.
25080504 2014 LRRK2 delays degradative receptor trafficking by impeding late endosomal budding through decreasing Rab7 activity.
24521780 2014 Human Rab7 mutation mimics features of Charcot-Marie-Tooth neuropathy type 2B in Drosophila.
24505328 2014 Supporting a role for the GTPase Rab7 in prostate cancer progression.
24498653 2014 A novel RAB7 mutation in a Chinese family with Charcot-Marie-Tooth type 2B disease.
24344282 2014 A mechanism for retromer endosomal coat complex assembly with cargo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23733193 2013 Rab family proteins regulate the endosomal trafficking and function of RGS4.
23562278 2013 The TBC/RabGAP Armus coordinates Rac1 and Rab7 functions during autophagy.
23536683 2013 Regulation of hepatitis B virus infection by Rab5, Rab7, and the endolysosomal compartment.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23188822 2013 Rab7 mutants associated with Charcot-Marie-Tooth disease cause delayed growth factor receptor transport and altered endosomal and nuclear signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23179371 2013 Charcot-Marie-Tooth type 2B disease-causing RAB7A mutant proteins show altered interaction with the neuronal intermediate filament peripherin.
22673115 2012 Identification of Alzheimer disease-associated variants in genes that regulate retromer function.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22638108 2012 Early to intermediate steps of tumor embolic formation involve specific proteolytic processing of E-cadherin regulated by Rab7.
22496312 2012 Echovirus 7 entry into polarized intestinal epithelial cells requires clathrin and Rab7.
22431521 2012 The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.
22261744 2012 Neuronal ceroid lipofuscinosis protein CLN3 interacts with motor proteins and modifies location of late endosomal compartments.
22115783 2012 Lysosomal targeting of phafin1 mediated by Rab7 induces autophagosome formation.
22072966 2011 Rab7A is required for efficient production of infectious HIV-1.
22042847 2011 Proteolytic targeting of Rab29 by an effector protein distinguishes the intracellular compartments of human-adapted and broad-host Salmonella.
21669283 2011 Upregulation of select rab GTPases in cholinergic basal forebrain neurons in mild cognitive impairment and Alzheimer's disease.
21438969 2011 A role for Rab7 in the movement of secretory granules in cytotoxic T lymphocytes.
21269460 2011 Initial characterization of the human central proteome.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
21151572 2010 Rab7 mutants associated with Charcot-Marie-Tooth disease exhibit enhanced NGF-stimulated signaling.
20974968 2010 Rubicon controls endosome maturation as a Rab7 effector.
20851765 2011 Rab7: role of its protein interaction cascades in endo-lysosomal traffic.
20847427 2010 Regional selectivity of rab5 and rab7 protein upregulation in mild cognitive impairment and Alzheimer's disease.
20709679 2010 [Mutation analysis of LITAF, RAB7, LMNA and MTMR2 genes in Chinese Charcot-Marie-Tooth disease.].
20472552 2010 Specific behavior of intracellular Streptococcus pyogenes that has undergone autophagic degradation is associated with bacterial streptolysin O and host small G proteins Rab5 and Rab7.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20363736 2010 Differential effects of TBC1D15 and mammalian Vps39 on Rab7 activation state, lysosomal morphology, and growth factor dependence.
20100911 2010 FYCO1 is a Rab7 effector that binds to LC3 and PI3P to mediate microtubule plus end-directed vesicle transport.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20048159 2010 Assembly of the biogenesis of lysosome-related organelles complex-3 (BLOC-3) and its interaction with Rab9.
20028791 2010 Disease mutations in Rab7 result in unregulated nucleotide exchange and inappropriate activation.
19956673 2009 An initial step of GAS-containing autophagosome-like vacuoles formation requires Rab7.
19651702 2009 Genes for hereditary sensory and autonomic neuropathies: a genotype-phenotype correlation.
19580780 2009 Dissection of Rab7 localization on Mycobacterium tuberculosis phagosome.
19564404 2009 Cholesterol sensor ORP1L contacts the ER protein VAP to control Rab7-RILP-p150 Glued and late endosome positioning.
19531583 2009 Membrane recruitment of the cargo-selective retromer subcomplex is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5.
19392663 2009 Rab7: roles in membrane trafficking and disease.
19372461 2009 Rab GTPase regulation of VEGFR2 trafficking and signaling in endothelial cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18974300 2008 Copper-induced translocation of the Wilson disease protein ATP7B independent of Murr1/COMMD1 and Rab7.
18955491 2008 Cholesterol accumulation by macrophages impairs phagosome maturation.
18787122 2008 The Salmonella virulence protein SifA is a G protein antagonist.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18501189 2008 Characterization of the Rab7K157N mutant protein associated with Charcot-Marie-Tooth type 2B.
18272684 2008 Functional characterization of Rab7 mutant proteins associated with Charcot-Marie-Tooth type 2B disease.
18039930 2007 Adenovirus RIDalpha regulates endosome maturation by mimicking GTP-Rab7.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17625594 2008 Rab7 regulates maturation of melanosomal matrix protein gp100/Pmel17/Silv.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17060578 2006 Charcot-Marie-Tooth disease due to a de novo mutation of the RAB7 gene.
17010938 2006 RILP interacts with VPS22 and VPS36 of ESCRT-II and regulates their membrane recruitment.
16965270 2006 Rab7 and Rab27a control two motor protein activities involved in melanosomal transport.
16925951 2006 Novel RING E3 ubiquitin ligases in breast cancer.
16631113 2006 A splice variant of RILP induces lysosomal clustering independent of dynein recruitment.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16282324 2006 rab7 activity affects epidermal growth factor:epidermal growth factor receptor degradation by regulating endocytic trafficking from the late endosome.
16176980 2005 The oxysterol-binding protein homologue ORP1L interacts with Rab7 and alters functional properties of late endocytic compartments.
15996637 2005 The Rab-interacting lysosomal protein, a Rab7 and Rab34 effector, is capable of self-interaction.
15933719 2005 Structural basis for recruitment of RILP by small GTPase Rab7.
15681833 2005 The Wilson disease protein ATP7B resides in the late endosomes with Rab7 and the Niemann-Pick C1 protein.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15455439 2004 A novel RAB7 mutation associated with ulcero-mutilating neuropathy.
15340014 2004 Role for Rab7 in maturation of late autophagic vacuoles.
15186776 2004 Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease.
15099588 2004 Clinical and electrophysiological characteristics of autosomal recessive axonal Charcot-Marie-Tooth disease (ARCMT2B) that maps to chromosome 19q13.3.
15078902 2004 Cargo-selective endosomal sorting for retrieval to the Golgi requires retromer.
14998988 2004 The proteasome alpha-subunit XAPC7 interacts specifically with Rab7 and late endosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14668488 2004 A unique region of RILP distinguishes it from its related proteins in its regulation of lysosomal morphology and interaction with Rab7 and Rab34.
14644159 2003 Endosomal trafficking of the Menkes copper ATPase ATP7A is mediated by vesicles containing the Rab7 and Rab5 GTPase proteins.
14617358 2003 Human VPS34 and p150 are Rab7 interacting partners.
12972561 2003 Rabring7, a novel Rab7 target protein with a RING finger motif.
12944476 2003 Phagosomes fuse with late endosomes and/or lysosomes by extension of membrane protrusions along microtubules: role of Rab7 and RILP.
12850305 2003 Characterization of the human RAB38 and RAB7 genes: exclusion of new major pathological loci for Japanese OCA.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12576024 2003 Crystallization and preliminary X-ray diffraction analysis of monoprenylated Rab7 GTPase in complex with Rab escort protein 1.
12545426 2003 Mutations in the small GTP-ase late endosomal protein RAB7 cause Charcot-Marie-Tooth type 2B neuropathy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12071695 2002 In vitro assembly, purification, and crystallization of the rab geranylgeranyl transferase:substrate complex.
12054610 2002 Rab7 gene is up-regulated by cholesterol-rich diet in the liver and artery.
12034881 2002 The endocytic catalysts, Rab5a and Rab7, are tandem regulators of thyroid hormone production.
11675392 2001 Phosphoisoprenoids modulate association of Rab geranylgeranyltransferase with REP-1.
11591706 2001 Double prenylation by RabGGTase can proceed without dissociation of the mono-prenylated intermediate.
11179213 2001 Rab-interacting lysosomal protein (RILP): the Rab7 effector required for transport to lysosomes.
11141079 2001 Allosteric regulation of substrate binding and product release in geranylgeranyltransferase type II.
10679007 2000 Rab7: a key to lysosome biogenesis.
10491170 1999 Characterization of the ternary complex between Rab7, REP-1 and Rab geranylgeranyl transferase.
10329441 1999 Interaction cloning and characterization of the cDNA encoding the human prenylated rab acceptor (PRA1).
9918381 1998 Cloning of Rab GTPases expressed in human skeletal muscle: studies in insulin-resistant subjects.
9792283 1998 Small GTP-binding proteins in human endothelial cells.
9585432 1998 Genetic mapping of the mouse Rab7 gene and pseudogene and of the human RAB7 homolog.
9563513 1998 Moderate discrimination of REP-1 between Rab7 x GDP and Rab7 x GTP arises from a difference of an order of magnitude in dissociation rates.
9428630 1997 NotI linking/jumping clones of human chromosome 3: mapping of the TFRC, RAB7 and HAUSP genes to regions rearranged in leukemia and deleted in solid tumors.
9126495 1997 Cloning and mapping of human Rab7 and Rab9 cDNA sequences and identification of a Rab9 pseudogene.
8954989 1996 Molecular cloning and expression analysis of the human Rab7 GTP-ase complementary deoxyribonucleic acid.
8910576 1996 Rab4 and Rab7 define distinct nonoverlapping endosomal compartments.
8702787 1996 Kinetics of interaction of Rab5 and Rab7 with nucleotides and magnesium ions.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2115402 1990 Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.