Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.00
PubTator Score 8.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.6e-11

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 2.6e-11

Gene RIF (9)

AA Sequence

MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTA      1 - 70
GQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIITLVGNRTDLADKRQVSVEE     71 - 140
GERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYS    141 - 210
PMSSSTLPQKPPYSFIDCSVNIGLNLFPSLITFCNSSLLPVSWR                              211 - 254
//

Text Mined References (20)

PMID Year Title