Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.37
PubTator Score 8.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.6e-11

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 2.6e-11

Gene RIF (8)

PMID Text
22949199 Rab6A'(Q72L) was then purified to homogeneity and crystallized at 293 K. X-ray diffraction data were collected to a resolution of 1.9 A from a crystal belonging to space group P22(1)2(1) with unit-cell parameters a = 36.84, b = 96.78, c = 109.99 A
20198315 Observational study of gene-disease association. (HuGE Navigator)
20064528 RAB6C is a rare example of a recently emerged retrogene that has acquired the status of a new gene, encoding a functional protein with altered characteristics compared to Rab6A'.
19851296 Observational study of gene-disease association. (HuGE Navigator)
18992151 plays role in multi-drug resistance development;DNA methylation is one of its transcription regulatory mechanisms
18187620 Knockdown of RAB6C, member RAS oncogene family by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17426708 The negative role played by the WTH3 gene in MDR development is through its proapoptotic potential that is regulated by multiple mechanisms at the transcription level, and one of these mechanisms is linked to the p53 gene.
16267028 The behavior of WTH3 in primary drug-resistant breast cancer epithelial cells was similar to that in a model system where epigenetic regulation of the WTH3 gene was linked to the MDR phenotype.

AA Sequence

MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTA      1 - 70
GQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIITLVGNRTDLADKRQVSVEE     71 - 140
GERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYS    141 - 210
PMSSSTLPQKPPYSFIDCSVNIGLNLFPSLITFCNSSLLPVSWR                              211 - 254
//

Text Mined References (19)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22949199 2012 Crystallization and preliminary X-ray crystallographic studies of Rab6A'(Q72L): a GTP-locked form.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20064528 2010 RAB6C is a retrogene that encodes a centrosomal protein involved in cell cycle progression.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18992151 2008 Methylation of WTH3, a possible drug resistant gene, inhibits p53 regulated expression.
17426708 2007 WTH3 is a direct target of the p53 protein.
16267028 2005 Epigenetic regulation of WTH3 in primary and cultured drug-resistant breast cancer cells.
16103095 2005 WTH3, which encodes a small G protein, is differentially regulated in multidrug-resistant and sensitive MCF7 cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12007787 2002 WTH3, a new member of the Rab6 gene family, and multidrug resistance.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11054569 2000 Rab6c, a new member of the rab gene family, is involved in drug resistance in MCF7/AdrR cells.
10455022 1999 Rab6 is phosphorylated in thrombin-activated platelets by a protein kinase C-dependent mechanism: effects on GTP/GDP binding and cellular distribution.
9847074 1998 Toward a complete human genome sequence.