Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.41
PubTator Score 8.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
ependymoma -2.600 1.0e-19
astrocytoma -1.200 3.1e-16
glioblastoma -3.000 3.0e-06
oligodendroglioma -1.300 4.7e-13
osteosarcoma -2.301 8.5e-06
medulloblastoma -2.100 9.2e-06
atypical teratoid / rhabdoid tumor -3.000 2.4e-10
medulloblastoma, large-cell -2.800 1.4e-05
primitive neuroectodermal tumor -1.800 1.2e-03
non-small cell lung cancer 1.394 5.1e-07
lung cancer 1.100 3.6e-03
pediatric high grade glioma -2.800 1.3e-08
pilocytic astrocytoma -2.800 1.6e-11
lung carcinoma 1.700 3.4e-29
Pick disease -1.400 2.0e-03
pituitary cancer 1.300 1.3e-04

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18044744 DYNLRB1 specifically interacts with all three Rab6 isoforms and co-localises at the Golgi.
17707369 The brain-specific Rab6B via Bicaudal-D1 is linked to the dynein/dynactin complex, suggesting a regulatory role for Rab6B in the retrograde transport of cargo in neuronal cells.
16790928 Conformational changes in human neuronal Rab6B between its inactive GDP and active GTP-like state are observed mainly in the switch I and switch II regions, confirming their role as a molecular switch.

AA Sequence

MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA      1 - 70
GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE     71 - 140
GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC      141 - 208
//

Text Mined References (19)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23737971 2013 A new Mint1 isoform, but not the conventional Mint1, interacts with the small GTPase Rab6.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18044744 2008 Rab6 family proteins interact with the dynein light chain protein DYNLRB1.
17707369 2007 A role for the Rab6B Bicaudal-D1 interaction in retrograde transport in neuronal cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16790928 2006 The structure of human neuronal Rab6B in the active and inactive form.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10893188 2000 The small GTPase Rab6B, a novel Rab6 subfamily member, is cell-type specifically expressed and localised to the Golgi apparatus.
9030196 1997 RAB GTPases expressed in human melanoma cells.