Property Summary

NCBI Gene PubMed Count 82
PubMed Score 134.46
PubTator Score 88.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 5.5e-04
Alzheimer's disease -1.300 2.6e-02
COPD -1.100 8.9e-03
lung cancer 1.300 2.3e-03
osteosarcoma 1.137 7.2e-03
Pick disease -1.600 7.8e-06

Gene RIF (33)

AA Sequence

MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA      1 - 70
GQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE     71 - 140
GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC      141 - 208
//

Text Mined References (95)

PMID Year Title