Property Summary

NCBI Gene PubMed Count 26
PubMed Score 11.08
PubTator Score 13.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.1e-05
glioblastoma 5572 1.4e-02
Disease Target Count Z-score Confidence
Argentine hemorrhagic fever 8 3.852 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -2.500 2.1e-05
glioblastoma 1.300 1.4e-02

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (5)

PMID Text
25368993 Enforced miR-509 expression in NALM6 cells reduced RAB5C mRNA and protein levels, and RAB5C was demonstrated to be a direct target of miR-509.
24604726 PLP2 and RAB5C are binding partners of TPD52.
24587345 Rab5C modulates Rac1-mediated cell motility.
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related protein Rab-5C (RAB5C), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22734003 GTP-Rab5c also bound to AMAP1, and activation of Rab5c by EGFR signaling was necessary to promote the intracellular association of AMAP1 and PRKD2

AA Sequence

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV      1 - 70
KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS     71 - 140
KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR    141 - 210
SQCCSN                                                                    211 - 216
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25368993 2014 Regulation of RAB5C is important for the growth inhibitory effects of MiR-509 in human precursor-B acute lymphoblastic leukemia.
24604726 2014 Identification of PLP2 and RAB5C as novel TPD52 binding partners through yeast two-hybrid screening.
24587345 2014 Rab5 isoforms orchestrate a "division of labor" in the endocytic network; Rab5C modulates Rac-mediated cell motility.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22734003 2012 Rab5c promotes AMAP1-PRKD2 complex formation to enhance ?1 integrin recycling in EGF-induced cancer invasion.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17897319 2007 Integral and associated lysosomal membrane proteins.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14741744 2004 Identification of major proteins in the lipid droplet-enriched fraction isolated from the human hepatocyte cell line HuH7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493736 2003 Determinants of Rab5 interaction with the N terminus of early endosome antigen 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10768959 2000 Deviant expression of Rab5 on phagosomes containing the intracellular pathogens Mycobacterium tuberculosis and Legionella pneumophila is associated with altered phagosomal fate.
10329441 1999 Interaction cloning and characterization of the cDNA encoding the human prenylated rab acceptor (PRA1).
9852039 1998 Interferon-gamma selectively induces Rab5a synthesis and processing in mononuclear cells.
8646882 1996 Isolation and mapping of a human gene (RABL) encoding a small GTP-binding protein homologous to the Ras-related RAB gene.
7951316 1994 A physical map and candidate genes in the BRCA1 region on chromosome 17q12-21.