Property Summary

NCBI Gene PubMed Count 36
PubMed Score 16.81
PubTator Score 16.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.800 5.6e-05
spina bifida -1.288 4.3e-02

Protein-protein Interaction (3)

Gene RIF (6)

PMID Text
25605758 results suggest that LRRK2 kinase activity functions as a Rab5b GTPase activating protein and thus, negatively regulates Rab5b signalling
24106282 combined genetic association studies in women from China/Netherlands/United States: Data suggest that an SNP in RAB5B locus (rs705702) and SNPs in other proteins are associated with polycystic ovary syndrome across ethnic differences. [META-ANALYSIS]
20526340 Observational study of gene-disease association. (HuGE Navigator)
19723633 suppression of Rab5A or 5B hampered the degradation of EGFR
18445495 Results suggest that LRRK2, in conjunction with its interaction with Rab5b, plays an important role in synaptic function by modulating the endocytosis of synaptic vesicles.
17927960 study shows expression of GTPase-deficient Rab5b in NRK cells results in sequential formation of 3 distinct types of endosomes; study suggests regulatory role for Rab5 in early & late endocytic pathway of membrane trafficking in coordination with PI(3)K

AA Sequence

MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVK      1 - 70
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANK     71 - 140
RMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKS    141 - 210
QCCSN                                                                     211 - 215
//

Text Mined References (42)

PMID Year Title
27314038 2016 G2385R and I2020T Mutations Increase LRRK2 GTPase Activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25605758 2015 An early endosome regulator, Rab5b, is an LRRK2 kinase substrate.
24106282 2013 Cross-ethnic meta-analysis of genetic variants for polycystic ovary syndrome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20526340 2010 Common variants in FOXP1 are associated with generalized vitiligo.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19723633 2009 Rab5 isoforms differentially regulate the trafficking and degradation of epidermal growth factor receptors.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18445495 2008 LRRK2 regulates synaptic vesicle endocytosis.
18198356 2008 A novel susceptibility locus for type 1 diabetes on Chr12q13 identified by a genome-wide association study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17927960 2007 A role for Rab5 activity in the biogenesis of endosomal and lysosomal compartments.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15326289 2004 Identification and proteomic profiling of exosomes in human urine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972505 2003 RIN3: a novel Rab5 GEF interacting with amphiphysin II involved in the early endocytic pathway.
12493736 2003 Determinants of Rab5 interaction with the N terminus of early endosome antigen 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11733506 2002 A novel binding protein composed of homophilic tetramer exhibits unique properties for the small GTPase Rab5.
11703925 2001 Ras-activated endocytosis is mediated by the Rab5 guanine nucleotide exchange activity of RIN1.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10491193 1999 Direct interaction of EEA1 with Rab5b.
10403367 1999 The small GTPases Rab5a, Rab5b and Rab5c are differentially phosphorylated in vitro.
9918381 1998 Cloning of Rab GTPases expressed in human skeletal muscle: studies in insulin-resistant subjects.
8666383 1995 Toward a cDNA map of the human genome.
7789520 1995 Co-operative regulation of endocytosis by three Rab5 isoforms.
1541686 1992 Identification and subcellular localization of human rab5b, a new member of the ras-related superfamily of GTPases.