1. Home
  2. Targets
  3. Ras-related protein Rab-5A

Tbio Ras-related protein Rab-5A

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed:10818110, PubMed:14617813, PubMed:16410077, PubMed:15378032). Contributes to the regulation of filopodia extension (PubMed:14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed:22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).

 Comments

Property Summary

NCBI Gene PubMed Count 160
PubMed Score 565.40
PubTator Score 389.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Myocardial Ischemia 169

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 2.000 4.2e-06
osteosarcoma 1.596 3.4e-04
medulloblastoma, large-cell -1.100 4.4e-04
intraductal papillary-mucinous adenoma (... 1.300 1.8e-02
pilocytic astrocytoma 1.200 1.6e-02
aldosterone-producing adenoma -1.145 4.3e-02
subependymal giant cell astrocytoma -1.681 4.6e-02
Gaucher disease type 1 -1.200 3.9e-02

Synonym

Accession P20339 B4DJA5 Q6FI44
Symbols RAB5

Gene

RAB5A

PDB

4Q9U   3MJH   1TU3   1N6H   1N6I   1N6K   1N6L   1N6N   1N6O   1N6P   1N6R   1R2Q   1TU4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (18)

See all...

 GO Function (3)

 GO Component (21)

See all...

 GO Process (15)

See all...

 Compartment GO Term (105)

See all...

 IMPC Phenotype (7)

 MGI Phenotype (2)

 HCA RNA Cell Line (56)

See all...

Pathway (34)

See all...

Protein-protein Interaction (77)

WASL   HGS   SYNJ2   SYNJ1   TGOLN2   DNAJC6   VAMP4   STAM2   EPN2   TFRC   TF   CLTA   CLTB   UBB   UBC   RAB3A   RAB4A   SYT1   AVPR2   GDI1   WNT5A   ARRB1   AMPH   GDI2   DNM2   VAMP7   CLTCL1   ARPC4   RAB1A   RPS27A   UBA52   VAMP2   DAB2   CLTC   OCRL   PICALM   RIN1   CTTN   GAPVD1   RABEP1   ITSN1   VAMP3   SLC18A3   AAK1   LDLRAP1   FNBP1L   KIAA0319   ALS2CL   SYT9   TBC1D3   SYT2   NECAP1   REPS2   RIN3   STON2   RIN2   STAM   SH3KBP1   REPS1   ALS2   FNBP1   RUFY1   SH3GL2   SGIP1   VAMP8   RBSN   VPS45   EPS15L1   RABGEF1   SNX9   EPN1   RAB5C   CHML   CHM   ATE1   RABGGTB   RABGGTA  

Gene RIF (101)

PMID Text
26680696 PLD1 recovers the decrease in epidermal growth factor receptor (EGFR) endocytosis induced by HIF-1alpha independent of lipase activity via the Rab5-mediated endosome fusion pathway.
26528697 Findings indicate the role of CMTM7 protein in the regulation of epidermal growth factor receptor (EGFR)-AKT proto-oncogene protein signaling in tumor cells, and as a molecule related to Rab5 GTP-binding protein activation.
26473288 Low expression of RAB5A is associated with metastasis in prostate cancer.
26344766 Data show that Rab22a- and Rab5a-driven phagosomal uptake is a crucial step in the vesicular cascade that leads to elimination of spirochetes by macrophages.
26261586 Higher expression of Rab5A was observed in colorectal cancer tissues and Rab5A may be identified as a useful predictor of metastasis and prognosis for CRC.
26195760 Membrane attack complexes activate noncanonical NF-kappaB by forming a novel Akt(+)NIK(+) signalosome on Rab5(+) endosomes.
26181205 Prelamin A/C was translocated to the nuclear membrane and formed a proper nuclear envelope. Rab5a was translocated to the early endosomes. The specific localizations of the prenylated proteins were dependent on intracellular oxygen concentration
26168723 findings suggest that Rab5 expression is required to maintain characteristics associated with cell transformation
26112597 Rab5a is a key mediator of LPS-induced vascular hyperpermeability.
26061722 HIV-1 Nef-HLA-A (MHCI) interaction localizes with RAB5A-positive early endosomes
25915798 HIV-1 Nef-HLA-A (MHCI) interaction localizes with RAB5A-positive early endosomes
25763873 Rab5 activation as a tumor cell migration switch
25711083 In serum-deprivated HeLa cells with low endocytic activity there two types of EEA1-vesicles: the first one carries the both EEA1 and Rab5 at high levels; the second consists of weakly decorated EEA1-vesicles that can be both Rab5-positive and -negative.
25566515 Bacteria controled the localization or function of host Rab5 and Rab7, and therefore modify the maturation from early to late phagosomes.[review]
25496667 HIV-1 Nef-HLA-A (MHCI) interaction localizes with RAB5A-positive early endosomes
25483964 vacuolin-1 activates RAB5A to block autophagosome-lysosome fusion
25179218 TNF-alpha augments invasion of Porphyromonas gingivalis in human gingival epithelial cells through increment of ICAM-1 and activation of Rab5.
25152371 This process is inhibited in the presence of a Rab5 dominant-negative mutant.
25049275 Overexpression of the GTPase RAB5A, a master regulator of endocytosis, is predictive of aggressive behavior and metastatic ability in human breast cancers.
24872409 a novel mechanism by which a PKC-Rab5a-Rac1 axis regulates cytoskeleton remodeling and T-cell migration, both of which are central for the adaptive immune response.
24848261 FGF21 has a role in promoting endothelial cell angiogenesis through a dynamin-2 and Rab5 dependent pathway
24788845 Hepatitis B virus can downregulate miR-101-3p expression by inhibiting its promoter activity and that downregulation of miR-101-3p promotes hepatocellular carcinoma cell proliferation and migration by targeting Rab5a.
24727246 Recent studies have shown that the activation of Rab5 is a critical event for maintaining the dynamics of focal adhesions, which is fundamental in regulating not only cell migration but also tumor cell invasion
24659799 activation, which is required for cell migration is promoted by Caveolin-1
24587345 Rab5 isoforms selectively oversee the multiple signaling and trafficking events associated with the endocytic network.
24576301 The predominant pathway mediated by Australian bat lyssavirus G envelope for internalization into HEK293T cells is clathrin-and actin-dependent also requiring Rab5.
24466349 vinculin binds to Rab5 and is required for Staphylococcus aureus uptake in cells.
23940042 clathrin interacts with Rab5 and plays a fundamental role in the entry and intracellular survival of B. abortus via interaction with lipid rafts and actin rearrangement
23815289 Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.
23813952 Rab5 activation is required to enhance cancer cell migration and invasion by promoting focal adhesion disassembly.
23733193 Data indicate that Rab5, Rab7 and Rab11 are involved in RGS4 traffics through plasma membrane recycling or endosome.
23687301 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
23606746 Rab5a, Rab8a and Rab14 are major regulators of MT1-MMP trafficking and invasive migration of primary human macrophages.
23536683 HBV infection strongly depends on host Rab5 and Rab7 expression.
23454239 Dominant negative (GDP-locked)-Rab5 and -Rab11 reproduced the effects of inhibitors of tubulin and actin, respectively, on the cycling of bradykinin B receptor.
23434372 In mammalian cells, p110beta acts as a molecular sensor for growth factor availability and induces autophagy by activating a Rab5-mediated signaling cascade
23291133 Rab5a and APPL1 are overexpressed in breast cancer, and are positively correlated with the HER-2 expression.
23182941 Endoplasmic membrane protein complex subunit 6 (EMC6) interacted with both RAB5A and BECN1/Beclin 1 and colocalized with the omegasome marker ZFYVE1/DFCP1.
23086000 These findings highlight Rab5 GTPase as a key regulator of P2X4 receptor cell surface expression and internalisation
23048039 Interaction of Rabex-5 with Rab5 depends on interaction of the MIU domain with the ubiquitinated L1 to drive its internalization.
22942286 TGF-beta1 can induce epithelial-to-mesenchymal transition through reduction in SARA expression, SARA is also basally regulated by its interaction with PI3K.
22547071 regulation of PI(3)P synthesis by Rab5 and Vps21 is essential for TORC1 function in both contexts.
22341461 Recruitment of the inositol 5-phosphatases OCRL and Inpp5b to the Yersinia-filled prevacuoles and subsequent phosphatidylinositol 4,5-diphosphate hydrolysis required the association of the GTPase Rab5 with prevacuoles.
22178872 Rab5A also binds the II-III loop of the Ca(v)2.3 calcium channel and exerts an inhibitory effect on APLP1 mediated channel internalization.
21987812 Rab5 forms a complex with a subset of CENP-F in mitotic cells and regulates the kinetics of release of CENP-F from the nuclear envelope and its accumulation on kinetochores.
21895870 Rab5A is associated with axillary lymph node metastasis in breast cancer patients.
21849022 Knockdown of Rab5a expression decreases cancer cell motility and invasion through integrin-mediated signaling pathway.
21835792 Coimmunoprecipitation assay indicated that hepatitis C virus NS4B formed a complex with human Rab5 and Vps34, supporting the notion that Rab5 and Vps34 are involved in NS4B-induced autophagy.
21669283 Upregulated expression of rab4, rab5, rab7, and rab27 correlates with antemortem measures of cognitive decline in individuals with mild cognitive impairment and Alzheimer's disease.
21655223 SUN2 was redistributed to endosomes upon overexpression of Rab5, but remained on the nuclear envelope when the SUN domain was deleted.
21640764 results suggest that Rab5 is involved in CB2 endocytosis and that internalized receptors are recycled via a Rab11 associated pathway rather than the rapid Rab4 associated pathway.
21500550 RABEX-5 and RAB5 may be involved in the development of breast cancer metastasis.
21423773 Dmkndelta activates Rab5 function and thus is involved in the early endosomal trafficking.
21203429 upon ligand activation, CysLT(1)R is tyrosine-phosphorylated and released from heterodimers with CysLT(2)R and, subsequently, internalizes from the plasma membrane to the nuclear membrane in a clathrin-, arrestin-3-, and Rab-5-dependent manner
21104291 Rab5a plays a role in LHR trafficking by facilitating internalization and fusion to early endosomes, increasing the degradation of internalized receptor resulting in a reduction in LHR recycling.
20926780 These data suggest that proteasomes regulate claudin-1 localization at the plasma membrane, which changes upon proteasomal inhibition to a Rab5a-mediated endosomal localization.
20847427 Results indicate selective upregulation of Both rab5 and rab7 levels within basal forebrain, frontal cortex, and hippocampus in mild cognitive impairment and Alzheimer's disease.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20558162 Increased expression of early endosomal marker Rab5 correlates well with intracellular protein deposition in sporadic motor neuron disease.
20472552 Rab5 and Rab7, were associated with the pathway of autophagosome formation and the fate of intracellular group A streptococcus.
20457610 Data demonstrate a key role of Rab and Arf family small GTPases and intracellular trafficking in mTORC1 activation.
20412119 Rab5a promoted proliferation of ovarian cancer cells, which may be associated with the APPL1-related epidermal growth factor signaling pathway.
20376209 Rab5(Q79L) interacts with the carboxyl terminus of RUFY3
19923319 These studies identify Rab5 as a key integrator of caspase-8-mediated signal transduction downstream of integrins, regulating cell survival and migration in vivo and in vitro.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19830447 The Rab5(Q79L) not only induces formation of enlarged early endosomes but also causes enlargement of later endocytic profiles.
19819222 The objective of the current study was to perform a detailed examination of the structural flexibility of the phosphate-binding loop (P-loop) as well as the switch I and II regions of human Rab5a upon its binding with GTP.
19759177 Data report the identification of Rab22 as a binding site on early endosomes for direct recruitment of Rabex-5 and activation of Rab5, establishing a Rab22-Rab5 signaling relay to promote early endosome fusion.
19723633 suppression of Rab5A or 5B hampered the degradation of EGFR
19656886 Borna Disease Virus cell entry was Rab5 dependent and exhibited rapid fusion kinetics.
19620308 HIV-1 Nef-HLA-A (MHCI) interaction localizes with RAB5A-positive early endosomes
19372461 Rab GTPase regulation of VEGFR2 trafficking and signaling in endothelial cells; Endothelial cell migration was increased by Rab5a depletion but decreased by Rab7a depletion
19126785 oxytocin receptors localize in vesicles containing the Rab5 and Rab4 small GTPases
19118546 Mutations in the Vps9 domain of Rin1 lead to a loss-of-function phenotype, indicating a specific structure-function relationship between Rab5 and Rin1.
19032933 Specific residues of RIN1 are required for its interaction with Rab5, binding to the endosomal membranes and subsequent regulation of the fusion reaction.
18982021 AdipoR1 is internalized through a clathrin- and Rab5-dependent pathway and that endocytosis may play a role in the regulation of adiponectin signaling.
18974049 caspase 8 has a role as a modulator of p85alpha Rab5-GAP activity and endosomal trafficking
18957427 Rab5 is a critical regulator of syndecan-1 shedding that serves as an on-off molecular switch through its alternation between the GDP-bound and GTP-bound forms.
18725540 SopB mediates PI(3)P production on the SCV indirectly through recruitment of Rab5 and its effector Vps34.
18005733 B coxsackievirus entry depends on occludin and require the activity of Rab34, Ras, and Rab5, GTPases known to regulate macropinocytosis.
17611268 Rab5 activation via amyloid precursor protein signal pathway mediates neuronal apoptosis.
17581628 The crystal structures of human APPL1 N-terminal BAR-PH domain motif, is reported.
17524504 Results suggest that Rab5 and RalA regulate P-gp trafficking between the plasma membrane and an intracellular compartment.
17473071 TSH controls Rab5a activity by promoting its GTP-bound state
17301152 Rab 5 is required for the cellular entry of dengue and West Nile viruses.
17301141 Rab5 participates in the hepatitis C virus RNA replication machinery.
17173037 We show that EGF relocates to the cell centre in a dynein-dependent fashion, concomitant with the sorting away of transferrin receptor, although it remains in Rab5-positive early endosomes.
16554017 Taken together, these results demonstrate that Rab5 is required for insulin receptor membrane trafficking and signaling.
15388334 These results suggest that amyotrophic lateral sclerosis 2 C-terminal like (ALS2CL), a novel ALS2 homologue, modulates Rab5-mediated endosome dynamics in HeLa cells.
15328530 Rab5 regulates and coordinates different endocytic mechanisms through its effector Rabankyrin-5
15023538 Guanine nucleotide binding state of rab5 has no bearing on the rate of EGFR endocytosis. However, expression of dominant negative rab5 affects downstream endocytic trafficking by slowing the ligand-induced disappearance of total cellular EGFR.
15016378 identification of a pathway directly linking the small GTPase Rab5, a key regulator of endocytosis, to signal transduction and mitogenesis via APPL1 and APPL2, two Rab5 effectors
14669515 Cell cycle was lengthened by blocking or reducing expression of RAB5A G81R mutation.
14644159 increase in the concentration of copper in the medium (189 microM) rapidly induces a redistribution of the MNK protein from early sorting endosomes, positive for Rab5-myc protein, to late endosomes, containing the Rab7-myc protein
12761223 In Rab5 overexpressing cells, the levels of beta-cleaved amyloid precursor protein (APP) carboxyl-terminal fragments (betaCTF), the rate-limiting proteolytic intermediate in Abeta generation, were increased
12668728 dynamin2 and Rab5 have roles in endocytosis of lysophosphatidic acid-coupled LPA1/EDG-2 receptors
12433916 Rab5a has a P-loop backbone amide group, which is required for catalysis
12432064 effect of SARA on rab5-mediated endocytosis
12034881 an endocytotic catalyst, a tandem regulator of thyroid hormone production
11884531 Rab5a regulates fusion between pathogen-containing phagosomes and cytoplasmic organelles in human neutrophils
11792815 Expression of a GTPase-hydrolysis-defective rab5a affects lysosome biogenesis by alteration of traffic between lysosomes and endosomes.

AA Sequence 

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK      1 - 70
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK     71 - 140
RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN    141 - 210
QCCSN                                                                     211 - 215
//

Text Mined References (169)

PMID Year Title
26680696 2015 The pleckstrin homology domain of phospholipase D1 accelerates EGFR endocytosis by increasing the expression of the Rab5 effector, rabaptin-5.
26528697 2015 CMTM7 knockdown increases tumorigenicity of human non-small cell lung cancer cells and EGFR-AKT signaling by reducing Rab5 activation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26473288 2015 Endosomal gene expression: a new indicator for prostate cancer patient prognosis?
26344766 2015 ER-Coordinated Activities of Rab22a and Rab5a Drive Phagosomal Compaction and Intracellular Processing of Borrelia burgdorferi by Macrophages.
26261586 2015 Increased expression of Rab5A predicts metastasis and poor prognosis in colorectal cancer patients.
26195760 2015 Complement membrane attack complexes activate noncanonical NF-?B by forming an Akt+ NIK+ signalosome on Rab5+ endosomes.
26181205 2015 Intracellular oxygen determined by respiration regulates localization of Ras and prenylated proteins.
26168723 2015 Down-regulation of Rab5 decreases characteristics associated with maintenance of cell transformation.
26112597 2015 Rab5-mediated VE-cadherin internalization regulates the barrier function of the lung microvascular endothelium.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25869668 2015 Sac2/INPP5F is an inositol 4-phosphatase that functions in the endocytic pathway.
25763873 2014 Rab5 activation as a tumor cell migration switch.
25711083 2014 [Analysis of vesicle subpopulations carrying early endosomal autoantigen EEA1].
25566515 2014 The complexity of Rab5 to Rab7 transition guarantees specificity of pathogen subversion mechanisms.
25483964 2014 Vacuolin-1 potently and reversibly inhibits autophagosome-lysosome fusion by activating RAB5A.
25179218 2014 TNF-? augmented Porphyromonas gingivalis invasion in human gingival epithelial cells through Rab5 and ICAM-1.
25152371 2014 Ligand stimulation induces clathrin- and Rab5-dependent downregulation of the kinase-dead EphB6 receptor preceded by the disruption of EphB6-Hsp90 interaction.
25049275 2014 A RAB5/RAB4 recycling circuitry induces a proteolytic invasive program and promotes tumor dissemination.
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24872409 2014 Phosphorylation of Rab5a protein by protein kinase C? is crucial for T-cell migration.
24848261 2014 FGF21 promotes endothelial cell angiogenesis through a dynamin-2 and Rab5 dependent pathway.
24788845 2014 Downregulation of miR-101-3p by hepatitis B virus promotes proliferation and migration of hepatocellular carcinoma cells by targeting Rab5a.
24727246 2014 Rab'ing tumor cell migration and invasion: focal adhesion disassembly driven by Rab5.
24659799 2014 Rab5 is required in metastatic cancer cells for Caveolin-1-enhanced Rac1 activation, migration and invasion.
24587345 2014 Rab5 isoforms orchestrate a "division of labor" in the endocytic network; Rab5C modulates Rac-mediated cell motility.
24576301 2014 Host cell virus entry mediated by Australian bat lyssavirus G envelope glycoprotein occurs through a clathrin-mediated endocytic pathway that requires actin and Rab5.
24466349 2014 Vinculin and Rab5 complex is required [correction of requited]for uptake of Staphylococcus aureus and interleukin-6 expression.
24440914 2014 Regulation of autophagy by the Rab GTPase network.
24334765 2014 The tumor susceptibility gene TMEM127 is mutated in renal cell carcinomas and modulates endolysosomal function.
23940042 2013 Interplay between clathrin and Rab5 controls the early phagocytic trafficking and intracellular survival of Brucella abortus within HeLa cells.
23815289 2013 Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.
23813952 2013 Rab5 activation promotes focal adhesion disassembly, migration and invasiveness in tumor cells.
23733193 2013 Rab family proteins regulate the endosomal trafficking and function of RGS4.
23687301 2013 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
23606746 2013 A specific subset of RabGTPases controls cell surface exposure of MT1-MMP, extracellular matrix degradation and three-dimensional invasion of macrophages.
23536683 2013 Regulation of hepatitis B virus infection by Rab5, Rab7, and the endolysosomal compartment.
23454239 2013 Inhibitory effects of cytoskeleton disrupting drugs and GDP-locked Rab mutants on bradykinin B? receptor cycling.
23434372 2013 Class IA PI3K p110? subunit promotes autophagy through Rab5 small GTPase in response to growth factor limitation.
23382462 2013 RabGEFs are a major determinant for specific Rab membrane targeting.
23291133 2012 [Expression and significance of Rab5a and APPL1 in breast cancer].
23182941 2013 A novel ER-localized transmembrane protein, EMC6, interacts with RAB5A and regulates cell autophagy.
23086000 2013 Rab5 regulates internalisation of P2X4 receptors and potentiation by ivermectin.
23048039 2012 Spatiotemporal regulation of the ubiquitinated cargo-binding activity of Rabex-5 in the endocytic pathway.
22942286 2012 Phosphatidylinositol 3-kinase and Rab5 GTPase inversely regulate the Smad anchor for receptor activation (SARA) protein independently of transforming growth factor-?1.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22547071 2012 Rab5 proteins regulate activation and localization of target of rapamycin complex 1.
22431521 2012 The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.
22341461 2012 Yersinia entry into host cells requires Rab5-dependent dephosphorylation of PI(4,5)P? and membrane scission.
22178872 2011 APLP1 and Rab5A interact with the II-III loop of the voltage-gated Ca-channel Ca(v)2.3 and modulate its internalization differently.
21987812 2011 Small GTPase Rab5 participates in chromosome congression and regulates localization of the centromere-associated protein CENP-F to kinetochores.
21895870 2011 Rab5A is associated with axillary lymph node metastasis in breast cancer patients.
21849022 2011 Knockdown of Rab5a expression decreases cancer cell motility and invasion through integrin-mediated signaling pathway.
21835792 2011 Rab5 and class III phosphoinositide 3-kinase Vps34 are involved in hepatitis C virus NS4B-induced autophagy.
21669283 2011 Upregulation of select rab GTPases in cholinergic basal forebrain neurons in mild cognitive impairment and Alzheimer's disease.
21655223 2011 Subcellular localization of SUN2 is regulated by lamin A and Rab5.
21640764 2011 Cannabinoid receptor 2 undergoes Rab5-mediated internalization and recycles via a Rab11-dependent pathway.
21500550 2011 [The expression and clinical significance of RABEX-5 and RAB5 in breast cancer].
21423773 2011 The ubiquitous dermokine delta activates Rab5 function in the early endocytic pathway.
21378754 2011 A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1.
21300063 2011 Defective relocalization of ALS2/alsin missense mutants to Rac1-induced macropinosomes accounts for loss of their cellular function and leads to disturbed amphisome formation.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21203429 2010 Ligand-induced tyrosine phosphorylation of cysteinyl leukotriene receptor 1 triggers internalization and signaling in intestinal epithelial cells.
21104291 2011 The role of Rab5a GTPase in endocytosis and post-endocytic trafficking of the hCG-human luteinizing hormone receptor complex.
20926780 2011 Rab5a-mediated localization of claudin-1 is regulated by proteasomes in endothelial cells.
20847427 2010 Regional selectivity of rab5 and rab7 protein upregulation in mild cognitive impairment and Alzheimer's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20558162 2010 Increased neuronal Rab5 immunoreactive endosomes do not colocalize with TDP-43 in motor neuron disease.
20534488 2010 Structural basis for Rab GTPase recognition and endosome tethering by the C2H2 zinc finger of Early Endosomal Autoantigen 1 (EEA1).
20472552 2010 Specific behavior of intracellular Streptococcus pyogenes that has undergone autophagic degradation is associated with bacterial streptolysin O and host small G proteins Rab5 and Rab7.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20457610 2010 Regulation of mTORC1 by the Rab and Arf GTPases.
20412119 2010 Rab5a overexpression promoting ovarian cancer cell proliferation may be associated with APPL1-related epidermal growth factor signaling pathway.
20376209 2010 Rab5(Q79L) interacts with the carboxyl terminus of RUFY3.
19966785 2010 Rab27a and Rab27b control different steps of the exosome secretion pathway.
19923319 2010 Rab5 mediates caspase-8-promoted cell motility and metastasis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19830447 2010 Ultrastructural characterization of giant endosomes induced by GTPase-deficient Rab5.
19819222 2009 Insight into the molecular switch mechanism of human Rab5a from molecular dynamics simulations.
19759177 2009 Rabex-5 is a Rab22 effector and mediates a Rab22-Rab5 signaling cascade in endocytosis.
19723633 2009 Rab5 isoforms differentially regulate the trafficking and degradation of epidermal growth factor receptors.
19656886 2009 Cell entry of Borna disease virus follows a clathrin-mediated endocytosis pathway that requires Rab5 and microtubules.
19376974 2009 Roles for endocytic trafficking and phosphatidylinositol 4-kinase III alpha in hepatitis C virus replication.
19372461 2009 Rab GTPase regulation of VEGFR2 trafficking and signaling in endothelial cells.
19126785 2009 Intracellular trafficking of the human oxytocin receptor: evidence of receptor recycling via a Rab4/Rab5 "short cycle".
19118546 2009 Functional determinants of ras interference 1 mutants required for their inhbitory activity on endocytosis.
19032933 2009 Inhibition of early endosome fusion by Rab5-binding defective Ras interference 1 mutants.
18982021 2009 Endocytosis of adiponectin receptor 1 through a clathrin- and Rab5-dependent pathway.
18974049 2008 Caspase 8 promotes peripheral localization and activation of Rab5.
18957427 2008 Syndecan-1 ectodomain shedding is regulated by the small GTPase Rab5.
18767904 2008 Hrs and SNX3 functions in sorting and membrane invagination within multivesicular bodies.
18725540 2008 SopB promotes phosphatidylinositol 3-phosphate formation on Salmonella vacuoles by recruiting Rab5 and Vps34.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18005733 2007 Coxsackievirus entry across epithelial tight junctions requires occludin and the small GTPases Rab34 and Rab5.
17611268 2007 Rab5 mediates an amyloid precursor protein signaling pathway that leads to apoptosis.
17581628 2007 Structure of the APPL1 BAR-PH domain and characterization of its interaction with Rab5.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17524504 2007 The small GTPases Rab5 and RalA regulate intracellular traffic of P-glycoprotein.
17473071 2007 Thyrotropin activates guanosine 5'-diphosphate/guanosine 5'-triphosphate exchange on the rate-limiting endocytic catalyst, Rab5a, in human thyrocytes in vivo and in vitro.
17403676 2007 Rin1 interacts with signal-transducing adaptor molecule (STAM) and mediates epidermal growth factor receptor trafficking and degradation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17301152 2007 Rab 5 is required for the cellular entry of dengue and West Nile viruses.
17301141 2007 Participation of rab5, an early endosome protein, in hepatitis C virus RNA replication machinery.
17173037 2007 Dynein is required for receptor sorting and the morphogenesis of early endosomes.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16902405 2006 Membrane targeting and activation of the Lowe syndrome protein OCRL1 by rab GTPases.
16890161 2006 Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin.
16754960 2006 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16554017 2006 Role of Rab5 in insulin receptor-mediated endocytosis and signaling.
16525121 2006 Varp is a Rab21 guanine nucleotide exchange factor and regulates endosome dynamics.
16410077 2006 Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.
16381901 2006 The LIFEdb database in 2006.
16141272 2005 Real-time imaging of Rab3a and Rab5a reveals differential roles in presynaptic function.
16034420 2005 Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
15782196 2004 Three-chromophore FRET microscopy to analyze multiprotein interactions in living cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388334 2004 ALS2CL, the novel protein highly homologous to the carboxy-terminal half of ALS2, binds to Rab5 and modulates endosome dynamics.
15378032 2004 Structural basis of Rab5-Rabaptin5 interaction in endocytosis.
15377662 2004 The p85alpha subunit of phosphatidylinositol 3'-kinase binds to and stimulates the GTPase activity of Rab proteins.
15328530 2004 The Rab5 effector Rabankyrin-5 regulates and coordinates different endocytic mechanisms.
15078902 2004 Cargo-selective endosomal sorting for retrieval to the Golgi requires retromer.
15023538 2004 Expression of dominant negative rab5 in HeLa cells regulates endocytic trafficking distal from the plasma membrane.
15016378 2004 APPL proteins link Rab5 to nuclear signal transduction via an endosomal compartment.
15014045 2004 Role of Unc51.1 and its binding partners in CNS axon outgrowth.
14978216 2004 Regulation of dendritic branching and filopodia formation in hippocampal neurons by specific acylated protein motifs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684892 2004 Refinement of the structure of human Rab5a GTPase domain at 1.05 A resolution.
14669515 2003 [The effects of mutant site G81R of RAB5A on RAB5A function].
14644159 2003 Endosomal trafficking of the Menkes copper ATPase ATP7A is mediated by vesicles containing the Rab7 and Rab5 GTPase proteins.
14617813 2004 Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes.
14613930 2004 Endofin recruits TOM1 to endosomes.
14600265 2003 Visualization of Rab5 activity in living cells by FRET microscopy and influence of plasma-membrane-targeted Rab5 on clathrin-dependent endocytosis.
12972505 2003 RIN3: a novel Rab5 GEF interacting with amphiphysin II involved in the early endocytic pathway.
12761223 2003 Rab5-stimulated up-regulation of the endocytic pathway increases intracellular beta-cleaved amyloid precursor protein carboxyl-terminal fragment levels and Abeta production.
12668728 2003 Agonist-induced endocytosis of lysophosphatidic acid-coupled LPA1/EDG-2 receptors via a dynamin2- and Rab5-dependent pathway.
12612085 2003 The TRE17 oncogene encodes a component of a novel effector pathway for Rho GTPases Cdc42 and Rac1 and stimulates actin remodeling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433916 2003 High resolution crystal structures of human Rab5a and five mutants with substitutions in the catalytically important phosphate-binding loop.
12432064 2002 SARA, a FYVE domain protein, affects Rab5-mediated endocytosis.
12359748 2002 PRC17, a novel oncogene encoding a Rab GTPase-activating protein, is amplified in prostate cancer.
12034881 2002 The endocytic catalysts, Rab5a and Rab7, are tandem regulators of thyroid hormone production.
11884531 2002 Rab5a GTPase regulates fusion between pathogen-containing phagosomes and cytoplasmic organelles in human neutrophils.
11870209 2002 The small GTPase Rab22 interacts with EEA1 and controls endosomal membrane trafficking.
11703925 2001 Ras-activated endocytosis is mediated by the Rab5 guanine nucleotide exchange activity of RIN1.
11682489 2002 Rab5 association with the angiotensin II type 1A receptor promotes Rab5 GTP binding and vesicular fusion.
11536198 2001 Tyrosine phosphorylation of p190 RhoGAP by Fyn regulates oligodendrocyte differentiation.
11099046 2000 The Eps8 protein coordinates EGF receptor signalling through Rac and trafficking through Rab5.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11062261 2000 Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain.
10818110 2000 A novel membrane-anchored Rab5 interacting protein required for homotypic endosome fusion.
10722846 2000 Rab37 is a novel mast cell specific GTPase localized to secretory granules.
10512627 1999 General role of GDP dissociation inhibitor 2 in membrane release of Rab proteins: modulations of its functional interactions by in vitro and in vivo structural modifications.
10491193 1999 Direct interaction of EEA1 with Rab5b.
10329441 1999 Interaction cloning and characterization of the cDNA encoding the human prenylated rab acceptor (PRA1).
9730828 1998 Mechanism of Rab geranylgeranylation: formation of the catalytic ternary complex.
9697774 1998 EEA1 links PI(3)K function to Rab5 regulation of endosome fusion.
9045618 1997 The tuberous sclerosis 2 gene product, tuberin, functions as a Rab5 GTPase activating protein (GAP) in modulating endocytosis.
8831575 1996 Subcellular localization of the small GTPase Rab5a in resting and stimulated human neutrophils.
8521472 1995 Rabaptin-5 is a direct effector of the small GTPase Rab5 in endocytic membrane fusion.
8294464 1994 REP-2, a Rab escort protein encoded by the choroideremia-like gene.
7991565 1994 Rab geranylgeranyl transferase catalyzes the geranylgeranylation of adjacent cysteines in the small GTPases Rab1A, Rab3A, and Rab5A.
7957092 1994 Rab escort protein-1 is a multifunctional protein that accompanies newly prenylated rab proteins to their target membranes.
2501306 1989 The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.
2493636 1989 Nucleotide sequence of a rat cDNA: rab1B, encoding a rab1-YPT related protein.
1999336 1991 Chromosome assignment of four RAS-related RAB genes.
1516130 1992 The small GTPase rab5 functions as a regulatory factor in the early endocytic pathway.