Property Summary

NCBI Gene PubMed Count 69
PubMed Score 144.82
PubTator Score 98.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.425 1.3e-03
malignant mesothelioma -4.400 1.9e-09
hereditary spastic paraplegia -1.075 6.4e-03
pancreatic ductal adenocarcinoma liver m... -1.408 2.0e-02
lung cancer 1.100 5.9e-04
breast carcinoma 1.200 8.7e-03
non primary Sjogren syndrome sicca 1.300 4.2e-02
lung adenocarcinoma 1.376 1.2e-05
gastric carcinoma -1.100 6.6e-03
dermatomyositis -1.200 1.9e-02

Protein-protein Interaction (1)

Gene RIF (30)

PMID Text
26716952 Rab4 expression is up-regulated by laminar shear stress, which contributed to improved vascular endothelial cell autophagy and function.
26430212 The results contradict the model of feedback activation of Rab5 and instead indicate that Rbpt5 is recruited by both Rabex5 recognizing ubiquitylated cargo and by Rab4 to activate Rab5 in a feed-forward manner.
24835460 Together the findings indicate that Arl1 links Rab4-dependent formation of endosomal sorting domains with downstream assembly of adaptor protein complexes that constitute the endosomal sorting machinery.
24404161 HRES-1/Rab4 regulates autophagy through promoting the formation of LC3(+) autophagosomes and the preservation of mitochondria.
23792956 Data indicate that Rab4 regulates ether-a-go-go-related gene (hERG) channel density via neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2).
23019362 TBC1D16 is a GTPase activating protein for Rab4A that regulates transferrin receptor recycling and EGFR trafficking and signaling.
22825871 our findings suggest an evolutionarily conserved function of HDPTP-Rab4 in the regulation of endocytic trafficking, cell adhesion and migration.
21669283 Upregulated expression of rab4, rab5, rab7 and rab27 correlates with antemortem measures of cognitive decline in individuals with mild cognitive impairment and Alzheimer disease.
21501115 Thus down- or up-regulation of Rab4A expression or Rab4A function triggered inhibition or increase of procathepsin L secretion respectively.
20943774 Overexpression of Rab4 regulates angiotensin II type I receptor phosphorylation and sensitization.
20534812 These findings suggest that Rab14 and Rab4 act sequentially, together with RUFY1.
20209493 Findings substantiate the notion that modulation of the temporal and spatial distribution of P-gp in cancer cells may be a valid therapeutic strategy to alleviate the MDR phenotype, and signal to Rab4 as a potential target.
19797056 D-AKAP2 promotes accumulation of recycling proteins in the Rab4/Rab11-positive endocytic recycling compartment
19369423 Data show that within several minutes after initiating rapid endocytosis of B2ARs by the isoproterenol, bright "puffs" of locally increased surface fluorescence intensity representing discrete Rab4-dependent recycling events.
19302266 conclude that a recycling pathway regulated by Rab4A is a critical effector of VEGFR1 during branching morphogenesis of the vasculature
19201859 activation of mTOR causes the loss of TCRzeta in lupus T cells through HRES-1/Rab4-dependent lysosomal degradation.
19126785 oxytocin receptors localize in vesicles containing the Rab5 and Rab4 small GTPases
18688880 Cyclic AMP-mediated phosphoinositide-3-kinase-independent activation of Rab4 facilitates Ntcp translocation in a hepatoma cell line.
18550774 Both phosphorylated and nonphosphorylated MOR internalize via Rab5-dependent pathway after agonist stimulation, and the phosphorylated and nonphosphorylated MORs recycle through distinct vesicular trafficking pathways mediated by Rab4 and Rab11.
18432409 Expression of HRES-1/Rab4 is induced by HIV-1 Tat, which in turn down-regulates expression of CD4 and susceptibility to re-infection by HIV-1
18227069 elevated [5HT](ex)"paralyzes" the translocation of SERT from intracellular locations to the plasma membrane by controlling transamidation and Rab4-GTP formation
17786215 NDRG1 specifically interacts with constitutively active Rab4aQ67L mutant protein and not with GDP-bound Rab4aS22N mutant proving NDRG1 as a novel Rab4a effector
16935861 Regulation of CD4 expression via recycling by HRES-1/RAB4 controls susceptibility to HIV infection
16926431 CT229 of Chlamydia trachomatis interacts with and recruits Rab4A to the inclusion membrane and therefore may play a role in regulating the intracellular trafficking or fusogenicity of the chlamydial inclusion.
16413502 The study suggests that Rab4 regulates the channel through multiple mechanisms that include protein-protein interaction, GTP/GDP exchange, and channel protein trafficking.
16389071 critical element that regulates epithelial sodium channel (ENaC) function by GTP-GDP recycling and concomitant changes in ENaC expression at the cell surface and in intracellular pool
15907487 Rab4 specific residue His39 modulates the nucleotide binding pocket giving rise to a reduced rate for nucleotide hydrolysis and exchange
15689494 In contrast to Rab11, Rab4 is not involved in exocytosis
15292453 Data suggest that abnormal membrane recycling in Niemann-Pick type A and C lipid storage disease fibroblasts results from specific inhibition of rab4 function by excess cholesterol in early endosomes.
11786538 Rab coupling protein (RCP), a novel Rab4 and Rab11 effector protein

AA Sequence

MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTA      1 - 70
GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE     71 - 140
ASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQA    141 - 210
PNAQECGC                                                                  211 - 218
//

Text Mined References (73)

PMID Year Title
26716952 2016 Laminar Shear Stress Promotes Vascular Endothelial Cell Autophagy Through Upregulation with Rab4.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26430212 2015 Rabaptin5 is recruited to endosomes by Rab4 and Rabex5 to regulate endosome maturation.
25416956 2014 A proteome-scale map of the human interactome network.
24835460 2014 Rab4 orchestrates a small GTPase cascade for recruitment of adaptor proteins to early endosomes.
24404161 2014 HRES-1/Rab4 promotes the formation of LC3(+) autophagosomes and the accumulation of mitochondria during autophagy.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23792956 2013 Regulation of the human ether-a-go-go-related gene (hERG) channel by Rab4 protein through neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23019362 2012 TBC1D16 is a Rab4A GTPase activating protein that regulates receptor recycling and EGF receptor signaling.
22825871 2012 The Bro1-domain-containing protein Myopic/HDPTP coordinates with Rab4 to regulate cell adhesion and migration.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21669283 2011 Upregulation of select rab GTPases in cholinergic basal forebrain neurons in mild cognitive impairment and Alzheimer's disease.
21501115 2011 Procathepsin L secretion, which triggers tumour progression, is regulated by Rab4a in human melanoma cells.
21269460 2011 Initial characterization of the human central proteome.
20943774 2011 Rab GTPases bind at a common site within the angiotensin II type I receptor carboxyl-terminal tail: evidence that Rab4 regulates receptor phosphorylation, desensitization, and resensitization.
20534812 2010 Functional cross-talk between Rab14 and Rab4 through a dual effector, RUFY1/Rabip4.
20209493 2011 Rab4 interacts with the human P-glycoprotein and modulates its surface expression in multidrug resistant K562 cells.
19797056 2009 D-AKAP2 interacts with Rab4 and Rab11 through its RGS domains and regulates transferrin receptor recycling.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19590752 2009 Rab4b is a small GTPase involved in the control of the glucose transporter GLUT4 localization in adipocyte.
19570034 2009 GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation.
19369423 2009 Cargo-mediated regulation of a rapid Rab4-dependent recycling pathway.
19302266 2009 VEGFR1 (Flt1) regulates Rab4 recycling to control fibronectin polymerization and endothelial vessel branching.
19201859 2009 Activation of mammalian target of rapamycin controls the loss of TCRzeta in lupus T cells through HRES-1/Rab4-regulated lysosomal degradation.
19126785 2009 Intracellular trafficking of the human oxytocin receptor: evidence of receptor recycling via a Rab4/Rab5 "short cycle".
18688880 2008 Rab4 facilitates cyclic adenosine monophosphate-stimulated bile acid uptake and Na+-taurocholate cotransporting polypeptide translocation.
18550774 2008 Phosphorylation state of mu-opioid receptor determines the alternative recycling of receptor via Rab4 or Rab11 pathway.
18227069 2008 Serotonin transamidates Rab4 and facilitates its binding to the C terminus of serotonin transporter.
17786215 2007 The N-Myc down regulated Gene1 (NDRG1) Is a Rab4a effector involved in vesicular recycling of E-cadherin.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
16935861 2006 Regulation of CD4 expression via recycling by HRES-1/RAB4 controls susceptibility to HIV infection.
16926431 2006 The GTPase Rab4 interacts with Chlamydia trachomatis inclusion membrane protein CT229.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16413502 2006 Rab4GTPase modulates CFTR function by impairing channel expression at plasma membrane.
16389071 2006 Rab4 GTP/GDP modulates amiloride-sensitive sodium channel (ENaC) function in colonic epithelia.
16381901 2006 The LIFEdb database in 2006.
16034420 2005 Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
15907487 2005 High resolution crystal structures of human Rab4a in its active and inactive conformations.
15689494 2005 From sorting endosomes to exocytosis: association of Rab4 and Rab11 GTPases with the Fc receptor, FcRn, during recycling.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15326289 2004 Identification and proteomic profiling of exosomes in human urine.
15292453 2004 Elevated endosomal cholesterol levels in Niemann-Pick cells inhibit rab4 and perturb membrane recycling.
15280022 2004 Characterisation of the Rab binding properties of Rab coupling protein (RCP) by site-directed mutagenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14617813 2004 Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes.
12832475 2003 Insulin-induced GLUT4 translocation involves protein kinase C-lambda-mediated functional coupling between Rab4 and the motor protein kinesin.
12559036 2003 CD2AP/CMS regulates endosome morphology and traffic to the degradative pathway through its interaction with Rab4 and c-Cbl.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788822 2002 Divalent Rab effectors regulate the sub-compartmental organization and sorting of early endosomes.
11786538 2002 Rab coupling protein (RCP), a novel Rab4 and Rab11 effector protein.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11243854 2001 The small GTPase Rab4A interacts with the central region of cytoplasmic dynein light intermediate chain-1.
11172003 2001 A FYVE-finger-containing protein, Rabip4, is a Rab4 effector involved in early endosomal traffic.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11063739 2001 Direct interaction of Rab4 with syntaxin 4.
10888662 2000 Accumulation of rab4GTP in the cytoplasm and association with the peptidyl-prolyl isomerase pin1 during mitosis.
10698684 2000 Rabaptin4, a novel effector of the small GTPase rab4a, is recruited to perinuclear recycling vesicles.
10512627 1999 General role of GDP dissociation inhibitor 2 in membrane release of Rab proteins: modulations of its functional interactions by in vitro and in vivo structural modifications.
10329441 1999 Interaction cloning and characterization of the cDNA encoding the human prenylated rab acceptor (PRA1).
9524117 1998 Distinct Rab-binding domains mediate the interaction of Rabaptin-5 with GTP-bound Rab4 and Rab5.
9013719 1997 Rab4 associates with the actin terminal web in developing rat pancreatic acinar cells.
8356066 1993 Identification of small GTP-binding rab proteins in human platelets: thrombin-induced phosphorylation of rab3B, rab6, and rab8 proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8112321 1994 Rab4 is phosphorylated by the insulin-activated extracellular-signal-regulated kinase ERK1.
2501306 1989 The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.
2493636 1989 Nucleotide sequence of a rat cDNA: rab1B, encoding a rab1-YPT related protein.
1999336 1991 Chromosome assignment of four RAS-related RAB genes.
1902553 1991 Phosphorylation of two small GTP-binding proteins of the Rab family by p34cdc2.
1425574 1992 Reversible phosphorylation--dephosphorylation determines the localization of rab4 during the cell cycle.
1117200 1975 Short-term metabolism of (14-C) tryptophan in rats infected with Trypanosoma brucei gambiense.