Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.56
PubTator Score 6.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.200 1.2e-03
posterior fossa group A ependymoma -5.800 5.7e-26
oligodendroglioma -2.800 1.1e-17
glioblastoma -4.900 2.1e-06
osteosarcoma -2.791 2.2e-09
sonic hedgehog group medulloblastoma -3.200 1.6e-06
atypical teratoid / rhabdoid tumor -5.100 7.2e-09
medulloblastoma, large-cell -3.600 1.8e-05
primitive neuroectodermal tumor -2.400 2.1e-02
adrenocortical carcinoma 1.033 2.1e-02
interstitial cystitis 1.300 8.6e-04
pediatric high grade glioma -4.600 3.4e-09
pilocytic astrocytoma -3.200 5.4e-09
lung carcinoma 4.300 5.5e-54
Pick disease -2.200 1.8e-02

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19717423 Rab3b/3c-positive recycling vesicles are involved in and may constitute one of the recycling compartments in exogenous antigen cross-presentation.
19240061 Observational study of gene-disease association. (HuGE Navigator)
12296628 cloning, mapping, and characterization; expressed in the brain, placenta, and lung; maps to chromosome 5q13

AA Sequence

MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK      1 - 70
TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL     71 - 140
VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ    141 - 210
NTRLKETPPPPQPNCAC                                                         211 - 227
//

Text Mined References (16)

PMID Year Title
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15159548 2004 Noc2 is essential in normal regulation of exocytosis in endocrine and exocrine cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12578829 2003 Distinct Rab binding specificity of Rim1, Rim2, rabphilin, and Noc2. Identification of a critical determinant of Rab3A/Rab27A recognition by Rim2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12296628 2002 Cloning, mapping, and characterization of the human Rab3C gene.
12167638 2002 Localization versus function of Rab3 proteins. Evidence for a common regulatory role in controlling fusion.
8543030 1995 Insulin-dependent translocation of the small GTP-binding protein rab3C in cardiac muscle: studies on insulin-resistant Zucker rats.