Property Summary

NCBI Gene PubMed Count 59
PubMed Score 203.15
PubTator Score 119.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -3.200 2.8e-21
malignant mesothelioma -2.700 2.0e-06
astrocytoma -2.300 6.5e-25
oligodendroglioma -2.300 2.5e-20
psoriasis -2.200 4.7e-05
glioblastoma multiforme -2.600 1.4e-28
sonic hedgehog group medulloblastoma -2.000 8.8e-05
atypical teratoid/rhabdoid tumor -2.800 2.1e-08
medulloblastoma, large-cell -1.100 1.9e-03
pediatric high grade glioma -2.700 1.6e-07
pilocytic astrocytoma -2.700 1.4e-09
lung carcinoma 2.300 1.1e-44

Gene RIF (16)

PMID Text
25713146 Data indicate that exocytic stimuli promote ADP ribosylation factor 6 (ARF6) activation, which accomplishes exocytosis by stimulating Rab3A GTP-Binding Protein.
25613138 The gene expression of RAB3A is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24965146 Rab3a accelerates cell proliferation by increasing cyclin D1 expression, enhances anti-cancer drug resistance, and increases tumorigenicity and self-renewal of glioma cells.
24652202 Five compounds which possess good inhibitory activity and may act as potential high affinity inhibitors against Rab3A active site were identified
23344955 alpha-Synuclein membrane association is regulated by the Rab3a recycling machinery and presynaptic activity
22753498 Rab27 and Rab3 sequentially regulate human sperm dense-core granule exocytosis.
21349835 Myo5a and Rab3A are direct binding partners and interact on synaptic vesicles and the Myo5a/Rab3A complex is involved in transport of neuronal vesicles
19923287 The maturation of amyloid precursor protein (APP) transport vesicles, including recruitment of conventional kinesin, requires Rab3A GTPase activity.
19546222 Epac activates the small G proteins Rap1 and Rab3A to achieve exocytosis
18559336 Rab3GEP has a role as the non-redundant guanine nucleotide exchange factor for Rab27a in melanocytes
17625073 Initiates exocytosis in acrosome when prenylated and activated with guanosine triphosphate (GTP).
16584842 Observational study of gene-disease association. (HuGE Navigator)
16584842 In conclusion, we have found no evidence for RAB3A conferring susceptibility on mental retardation in the Han Chinese population.
16099449 Cholesterol content regulates acrosomal exocytosis by enhancing Rab3A plasma membrane association.
15005721 Mutation screening of the RAB3A gene in 47 individuals with autism provided no evidence that DNA variants in this gene are associated with autism.
12937130 a possible role in glomerulopathies

AA Sequence

MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR      1 - 70
IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME     71 - 140
DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ    141 - 210
QVPPHQDCAC                                                                211 - 220
//

Text Mined References (60)

PMID Year Title
25713146 2015 ADP ribosylation factor 6 (ARF6) promotes acrosomal exocytosis by modulating lipid turnover and Rab3A activation.
25416956 2014 A proteome-scale map of the human interactome network.
24965146 2014 Rab3a promotes brain tumor initiation and progression.
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24652202 2014 3D structure generation, virtual screening and docking of human Ras-associated binding (Rab3A) protein involved in tumourigenesis.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23344955 2013 ?-Synuclein membrane association is regulated by the Rab3a recycling machinery and presynaptic activity.
22899725 2012 A complete Rab screening reveals novel insights in Weibel-Palade body exocytosis.
22753498 2012 Rab27 and Rab3 sequentially regulate human sperm dense-core granule exocytosis.
21349835 2011 Myosin5a tail associates directly with Rab3A-containing compartments in neurons.
19923287 2009 APP anterograde transport requires Rab3A GTPase activity for assembly of the transport vesicle.
19546222 2009 Epac activates the small G proteins Rap1 and Rab3A to achieve exocytosis.
18559336 2008 Rab3GEP is the non-redundant guanine nucleotide exchange factor for Rab27a in melanocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17625073 2007 Membrane-permeant Rab3A triggers acrosomal exocytosis in living human sperm.
16722236 2006 The role of SNARE proteins in trafficking and function of neurotransmitter transporters.
16584842 2006 Variants in the RAB3A gene are not associated with mental retardation in the Chinese population.
16099449 2005 Cholesterol content regulates acrosomal exocytosis by enhancing Rab3A plasma membrane association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
15159548 2004 Noc2 is essential in normal regulation of exocytosis in endocrine and exocrine cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15005721 2004 DNA variants in the human RAB3A gene are not associated with autism.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12937130 2003 Glomerular podocytes possess the synaptic vesicle molecule Rab3A and its specific effector rabphilin-3a.
12750892 2004 The SLC32 transporter, a key protein for the synaptic release of inhibitory amino acids.
12590134 2003 Slp4-a/granuphilin-a inhibits dense-core vesicle exocytosis through interaction with the GDP-bound form of Rab27A in PC12 cells.
12578829 2003 Distinct Rab binding specificity of Rim1, Rim2, rabphilin, and Noc2. Identification of a critical determinant of Rab3A/Rab27A recognition by Rim2.
12535645 2003 Structural determinants of Rab and Rab Escort Protein interaction: Rab family motifs define a conserved binding surface.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244319 2002 Mutations in Rab3a alter circadian period and homeostatic response to sleep loss in the mouse.
12176990 2002 Slp4-a/granuphilin-a regulates dense-core vesicle exocytosis in PC12 cells.
12051743 2002 Synaptotagmin-like protein 5: a novel Rab27A effector with C-terminal tandem C2 domains.
11884041 2002 SNARE complex assembly is required for human sperm acrosome reaction.
11846002 2001 Localization of the small monomeric GTPases Rab3D and Rab3A in the AtT-20 rat pituitary cell line.
11809763 2002 Rabconnectin-3, a novel protein that binds both GDP/GTP exchange protein and GTPase-activating protein for Rab3 small G protein family.
11773082 2002 The Slp homology domain of synaptotagmin-like proteins 1-4 and Slac2 functions as a novel Rab27A binding domain.
11563859 2001 Subcellular distribution and function of Rab3A-D in pancreatic acinar AR42J cells.
11516400 2001 GRAB: a physiologic guanine nucleotide exchange factor for Rab3A, which interacts with inositol hexakisphosphate kinase.
11377421 2001 The scaffolding protein CASK mediates the interaction between rabphilin3a and beta-neurexins.
11134008 2001 A direct inhibitory role for the Rab3-specific effector, Noc2, in Ca2+-regulated exocytosis in neuroendocrine cells.
10859313 2000 Biochemical characterization of Rab3-GTPase-activating protein reveals a mechanism similar to that of Ras-GAP.
10574328 1999 Genomic organisation of the human cyclic AMP-specific phosphodiesterase PDE4C gene and its chromosomal localisation to 19p13.1, between RAB3A and JUND.
10511453 1999 Phosphatidic acid is important to the translocation of Rab3A from the cytosol to phospholipid membranes.
10025402 1999 Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
9341137 1997 Isolation and characterization of a dual prenylated Rab and VAMP2 receptor.
9194562 1997 The small GTP-binding protein Rab3A regulates a late step in synaptic vesicle fusion.
9013620 1997 An evolutionarily conserved domain in a subfamily of Rabs is crucial for the interaction with the guanyl nucleotide exchange factor Mss4.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8706741 1996 Characterization of the interaction of the monomeric GTP-binding protein Rab3a with geranylgeranyl transferase II.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
8226995 1993 The Rab3A GTPase interacts with multiple factors through the same effector domain. Mutational analysis of cross-linking of Rab3A to a putative target protein.
8071310 1994 Functional identification of a vesicular acetylcholine transporter and its expression from a "cholinergic" gene locus.
7991565 1994 Rab geranylgeranyl transferase catalyzes the geranylgeranylation of adjacent cysteines in the small GTPases Rab1A, Rab3A, and Rab5A.
7532276 1995 Interaction cloning of Rabin3, a novel protein that associates with the Ras-like GTPase Rab3A.
2687157 1989 Chromosome mapping of the human ras-related rab3A gene to 19p13.2.
2501306 1989 The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.
2493636 1989 Nucleotide sequence of a rat cDNA: rab1B, encoding a rab1-YPT related protein.
1648736 1991 Isoprenoid modification of rab proteins terminating in CC or CXC motifs.