Property Summary

NCBI Gene PubMed Count 29
PubMed Score 38.07
PubTator Score 26.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.600 1.0e-04
osteosarcoma 1.391 8.9e-05
acute myeloid leukemia 2.100 1.9e-02
Gaucher disease type 1 -1.200 2.2e-02

Protein-protein Interaction (5)

Gene RIF (17)

PMID Text
26725203 Authors propose that the precise spatial and temporal activation of Rab35 acts as a major switch for OCRL recruitment on newborn endosomes, post-scission PtdIns(4,5)P2 hydrolysis, and subsequent endosomal trafficking.
26338797 Two somatic RAB35 mutations found in human tumors generate alleles that constitutively activate PI3K/AKT signaling, suppress apoptosis, and transform cells in a PI3K-dependent manner.
26229970 the activation-inactivation cycles of Rab35 and ARF6 are required for the uptake of zymosan and that ACAP2 is an important component that links Rab35/ARF6 signaling during phagocytosis of zymosan.
25988331 Rab35 serves as a clathrin-mediated endocytosis detector. Loss of Rab35 input leads to elevated Arf6-GTP and shifts the sorting of clathrin-independent endocytosis cargo proteins to lysosomes.
23353182 Rab35 acts as a downstream target of Dvl2 and mediates cell migration.
23264734 mutual regulation with arf6 of cell adhesion and migration
22226746 Activated ARF6 reduces Rab35 loading into the endocytic pathway.
22072793 whereas connecdenn 1 and 2 activate Rab35 for endosomal trafficking, connecdenn 3 uniquely activates Rab35 for its role in actin regulation
22065758 analysis of DENND1B-S complexed with its substrate Rab35
21706022 the phosphatidylinositol-4,5-bisphosphate (PtdIns(4,5)P2) 5-phosphatase OCRL, which is mutated in Lowe syndrome patients, is an effector of the Rab35 GTPase in cytokinesis abscission
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19729655 study found that Rab35 regulates the assembly of actin filaments in filopodia formation; effect was mediated by the actin-bundling protein fascin, which directly associated with active Rab35
18976975 Knockdown of RAB35, member RAS oncogene family by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18450757 EPI64C and Rab35 regulate a recycling pathway in T cells and contribute to immunological synapse formation, most likely by participating in TCR transport to the immunological synapse
16950109 localized to the plasma membrane and endocytic compartments and controls a fast endocytic recycling pathway; plays an essential role during the terminal steps of cytokinesis
16600182 A Small Ras-like GTPase protein Ray was indicated to modulate p53 transcriptional activity of PRPK.

AA Sequence

MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERF      1 - 70
RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAG     71 - 140
QMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC             141 - 201
//

Text Mined References (35)

PMID Year Title
26725203 2016 Rab35 GTPase Triggers Switch-like Recruitment of the Lowe Syndrome Lipid Phosphatase OCRL on Newborn Endosomes.
26338797 2015 Identification of an oncogenic RAB protein.
26229970 2015 Activation-Inactivation Cycling of Rab35 and ARF6 Is Required for Phagocytosis of Zymosan in RAW264 Macrophages.
25988331 2015 Sorting of Clathrin-Independent Cargo Proteins Depends on Rab35 Delivered by Clathrin-Mediated Endocytosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23353182 2013 Rab35 is required for Wnt5a/Dvl2-induced Rac1 activation and cell migration in MCF-7 breast cancer cells.
23264734 2013 Interplay between Rab35 and Arf6 controls cargo recycling to coordinate cell adhesion and migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22307087 2012 Reversible phosphocholination of Rab proteins by Legionella pneumophila effector proteins.
22226746 2012 An ARF6/Rab35 GTPase cascade for endocytic recycling and successful cytokinesis.
22072793 2012 Connecdenn 3/DENND1C binds actin linking Rab35 activation to the actin cytoskeleton.
22065758 2011 Insights regarding guanine nucleotide exchange from the structure of a DENN-domain protein complexed with its Rab GTPase substrate.
21951725 2012 MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
21706022 2011 Rab35 GTPase and OCRL phosphatase remodel lipids and F-actin for successful cytokinesis.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20154091 2010 The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery.
19729655 2009 Rab35 controls actin bundling by recruiting fascin as an effector protein.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18450757 2008 Rab35 and its GAP EPI64C in T cells regulate receptor recycling and immunological synapse formation.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16950109 2006 Rab35 regulates an endocytic recycling pathway essential for the terminal steps of cytokinesis.
16600182 2006 A Small Ras-like protein Ray/Rab1c modulates the p53-regulating activity of PRPK.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7811277 1994 Molecular cloning of two small GTP-binding proteins from human skeletal muscle.