Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.38
PubTator Score 8.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 2.3e-04
osteosarcoma 7933 2.8e-04
cystic fibrosis 1670 3.0e-04
psoriasis 6685 1.8e-03
pancreatic ductal adenocarcinoma liver metastasis 1795 2.8e-02
Disease Target Count Z-score Confidence
Osteochondrodysplasia 9 3.734 1.9
Disease Target Count
Smith-McCort dysplasia 2 1

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.400 1.8e-03
osteosarcoma -1.351 2.8e-04
pancreatic ductal adenocarcinoma liver m... -1.058 2.8e-02
cystic fibrosis -1.100 3.0e-04
ovarian cancer -1.200 2.3e-04

Protein-protein Interaction (12)

Gene RIF (5)

PMID Text
26975471 Arg-24 of Atg16L1 is crucial for its interaction with Atg5 which has implications in the binding of the dimeric complex to Rab33B
25439980 Analysis of hepatitis B virus capsid maturation steps revealed that Rab33B and Atg5/12/16L1 are required for proper particle assembly and/or stability.
23091056 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
22652534 A second autosomal recessive locus for Dyggve-Melchior-Clausen syndrome exists on 4q31.1 and that Rab protein-encoding gene, RAB33B, is the likely disease gene in that locus.
18448665 Rab33 modulates autophagosome formation through interaction with Atg16L

AA Sequence

MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDF      1 - 70
RERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLAND     71 - 140
IPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQP    141 - 210
PDNGIILKPEPKPAMTCWC                                                       211 - 229
//

Text Mined References (20)

PMID Year Title
26975471 2016 Deciphering the role of Atg5 in nucleotide dependent interaction of Rab33B with the dimeric complex, Atg5-Atg16L1.
25439980 2015 Rab33B and its autophagic Atg5/12/16L1 effector assist in hepatitis B virus naked capsid formation and release.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23091056 2012 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
23042644 2013 A novel RAB33B mutation in Smith-McCort dysplasia.
22899725 2012 A complete Rab screening reveals novel insights in Weibel-Palade body exocytosis.
22652534 2012 Mutation in RAB33B, which encodes a regulator of retrograde Golgi transport, defines a second Dyggve--Melchior--Clausen locus.
21808068 2011 RUTBC1 protein, a Rab9A effector that activates GTP hydrolysis by Rab32 and Rab33B proteins.
21269460 2011 Initial characterization of the human central proteome.
20163571 2010 Rab33b and Rab6 are functionally overlapping regulators of Golgi homeostasis and trafficking.
18448665 2008 Golgi-resident small GTPase Rab33B interacts with Atg16L and modulates autophagosome formation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11718716 2001 Identification of rabaptin-5, rabex-5, and GM130 as putative effectors of rab33b, a regulator of retrograde traffic between the Golgi apparatus and ER.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9512502 1998 A novel Rab GTPase, Rab33B, is ubiquitously expressed and localized to the medial Golgi cisternae.