Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.23
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03
astrocytoma -1.500 2.0e-02
atypical teratoid / rhabdoid tumor -2.000 6.6e-03
ependymoma -2.500 2.5e-02
glioblastoma -1.600 6.3e-03
group 3 medulloblastoma -2.100 2.8e-04
interstitial cystitis 1.300 4.7e-03
malignant mesothelioma 4.500 1.1e-09
medulloblastoma, large-cell -1.700 1.0e-02
osteosarcoma -1.683 4.3e-06
ovarian cancer -1.200 1.3e-08
Pick disease -1.400 2.4e-02
subependymal giant cell astrocytoma -2.299 4.6e-03
tuberculosis -1.400 8.7e-06

Gene RIF (1)

AA Sequence

MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIG      1 - 70
VDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAV     71 - 140
PPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY    141 - 210
RDAERQQGKVQKLEFPQEANSKTSCPC                                               211 - 237
//

Text Mined References (14)

PMID Year Title