Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.18
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 4.500 1.1e-09
posterior fossa group B ependymoma -2.700 2.4e-13
glioblastoma -1.600 6.3e-03
osteosarcoma -1.683 4.3e-06
astrocytoma -1.500 2.0e-02
atypical teratoid / rhabdoid tumor -2.000 6.6e-03
medulloblastoma, large-cell -1.700 1.0e-02
tuberculosis and treatment for 3 months -1.500 4.7e-05
interstitial cystitis 1.300 4.7e-03
pediatric high grade glioma -1.400 1.1e-03
group 3 medulloblastoma -2.100 2.8e-04
subependymal giant cell astrocytoma -2.299 4.6e-03
Pick disease -1.400 2.4e-02
ovarian cancer -1.200 1.3e-08

Gene RIF (1)

PMID Text
16136464 expression was down-regulated in patients with TB and was predominantly expressed in CD8+ T cells.

AA Sequence

MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIG      1 - 70
VDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAV     71 - 140
PPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY    141 - 210
RDAERQQGKVQKLEFPQEANSKTSCPC                                               211 - 237
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16136464 2005 Ras-associated small GTPase 33A, a novel T cell factor, is down-regulated in patients with tuberculosis.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9712825 1998 Rab GTPases, directors of vesicle docking.
9512502 1998 A novel Rab GTPase, Rab33B, is ubiquitously expressed and localized to the medial Golgi cisternae.
7688322 1993 Molecular cloning of a cDNA encoding a novel small GTP-binding protein.