Property Summary

NCBI Gene PubMed Count 23
PubMed Score 13.45
PubTator Score 15.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
chronic lymphocytic leukemia 1.154 4.6e-02
malignant mesothelioma -1.500 1.1e-05
oligodendroglioma 1.800 1.1e-02
psoriasis 2.300 1.9e-05
astrocytoma 1.500 2.8e-28
glioblastoma multiforme 1.400 1.4e-27
osteosarcoma 1.492 4.1e-04
posterior fossa group A ependymoma -1.300 8.0e-05
group 3 medulloblastoma -3.400 2.8e-07
medulloblastoma, large-cell -4.100 2.7e-06
Duchenne muscular dystrophy 1.538 5.6e-10
Becker muscular dystrophy 1.017 1.3e-03
juvenile dermatomyositis 1.140 3.0e-09
limb girdle muscular dystrophy 2A 1.001 4.9e-07
primary pancreatic ductal adenocarcinoma 3.551 1.3e-04
intraductal papillary-mucinous adenoma (... -1.400 4.1e-03
intraductal papillary-mucinous carcinoma... -1.300 2.6e-02
lung cancer -1.700 6.8e-05
pancreatic cancer 3.700 1.1e-04
Breast cancer 2.800 2.7e-02
interstitial cystitis 1.600 9.0e-06
pilocytic astrocytoma 2.100 2.3e-09
primary Sjogren syndrome 1.300 1.0e-02
aldosterone-producing adenoma -1.157 2.8e-02
lung adenocarcinoma -1.300 1.9e-05
invasive ductal carcinoma 2.055 4.7e-04
lung carcinoma -2.100 4.0e-34
breast carcinoma 1.200 1.2e-13
gastric carcinoma 2.400 6.7e-03
mucosa-associated lymphoid tissue lympho... 2.103 7.7e-03
ulcerative colitis 3.000 5.9e-07
ovarian cancer 4.300 4.7e-08
pituitary cancer -1.700 2.2e-05

Protein-protein Interaction (10)

Gene RIF (10)

PMID Text
26044564 this study provides the evidence of Rab31 overexpression in HCC, and Rab31 is potentially used as a novel biomarker of poor prognosis in patients with HCC. PI3K/AKT/Bcl-2/BAX axis was involved in Rab31-promoting HCC progression.
24644286 Data indicate that early endosome antigen 1 (EEA1) is important for the small GTPase Rab31-mediated enhancement of ligand-bound EGF receptor (EGFR) endocytic trafficking.
22920728 Overexpression of rab31 in breast cancer cells leads to a switch from an invasive to a proliferative phenotype as indicated by an increased cell proliferation, reduced adhesion and invasion in vitro, and a reduced capacity to form lung metastases in vivo.
22792175 MUC1-C and Rab31 function in an autoinductive loop that contributes to overexpression of MUC1-C in breast cancer cells.
21848504 Neither UPARwt, nor UPAR-del4/5 nor RAB31 mRNA expression levels were found to be prognostic markers in advanced ovarian cancer.
21586568 RIN3 specifically acts as a GEF for Rab31.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19725050 Rab22B possibly plays role in regulating epidermal growth factor receptor (EGFR) and mannose 6-phosphate receptor (M6PR) transport into late endosomes.
17952591 uPAR-del4/5 and rab31 mRNA represent independent prognostic markers in breast cancer and may be components of different, but possibly associated, tumor-relevant signaling pathways.
17678623 Thus, Rab22B may have a role in anterograde exit from the trans-Golgi network .

AA Sequence

MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSL      1 - 70
APMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESI     71 - 140
GAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC                    141 - 194
//

Text Mined References (29)

PMID Year Title
26044564 2015 Rab31 promoted hepatocellular carcinoma (HCC) progression via inhibition of cell apoptosis induced by PI3K/AKT/Bcl-2/BAX pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24644286 2014 Engagement of the small GTPase Rab31 protein and its effector, early endosome antigen 1, is important for trafficking of the ligand-bound epidermal growth factor receptor from the early to the late endosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22920728 2012 Rab31 expression levels modulate tumor-relevant characteristics of breast cancer cells.
22792175 2012 Cooperative interaction between the MUC1-C oncoprotein and the Rab31 GTPase in estrogen receptor-positive breast cancer cells.
21848504 2011 mRNA expression levels of the biological factors uPAR, uPAR-del4/5, and rab31, displaying prognostic value in breast cancer, are not clinically relevant in advanced ovarian cancer.
21586568 2011 Characterization of RIN3 as a guanine nucleotide exchange factor for the Rab5 subfamily GTPase Rab31.
21269460 2011 Initial characterization of the human central proteome.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19725050 2009 Rab22B is expressed in the CNS astroglia lineage and plays a role in epidermal growth factor receptor trafficking in A431 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17952591 2008 Urokinase receptor splice variant uPAR-del4/5-associated gene expression in breast cancer: identification of rab31 as an independent prognostic factor.
17678623 2007 Rab22B's role in trans-Golgi network membrane dynamics.
17189207 2007 Gapex-5, a Rab31 guanine nucleotide exchange factor that regulates Glut4 trafficking in adipocytes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11784320 2002 Molecular cloning, bacterial expression and properties of Rab31 and Rab32.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8863739 1996 Molecular cloning of two novel rab genes from human melanocytes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1178432 1975 Target size and luminance in apparent brightness of the peripheral visual field.