Property Summary

NCBI Gene PubMed Count 41
PubMed Score 108.68
PubTator Score 51.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.209 1.9e-02
astrocytic glioma -1.600 3.9e-02
ependymoma -1.900 2.7e-02
cutaneous lupus erythematosus -1.600 6.1e-03
psoriasis -1.300 1.9e-02
osteosarcoma 2.012 3.5e-07
atypical teratoid / rhabdoid tumor -1.100 4.3e-04
medulloblastoma, large-cell -1.400 7.9e-04
acute quadriplegic myopathy 1.002 1.7e-03
Atopic dermatitis -1.100 3.8e-03
intraductal papillary-mucinous adenoma (... 1.300 5.1e-04
intraductal papillary-mucinous carcinoma... 1.200 1.3e-03
Parkinson's disease -1.400 1.7e-02
Breast cancer 3.200 4.1e-02
cystic fibrosis -1.500 7.1e-04
adult high grade glioma -1.200 2.2e-03
non primary Sjogren syndrome sicca 1.400 1.8e-02
subependymal giant cell astrocytoma -1.014 3.4e-02
lung adenocarcinoma 1.379 1.2e-05
spina bifida -1.128 4.3e-02
ovarian cancer 3.600 1.1e-08

Protein-protein Interaction (6)

Gene RIF (13)

PMID Text
26938441 This study demonstrated that RAB2A mutation showing the highest statistical significance in Autism and Schizophrenia.
26249043 RAB2A variance has effect on the structure and function of the PFC and related cognitive functions.
26159854 The immunohistochemistry-based validation using tissue microarray slides in oral squamous cell carcinoma revealed overexpression of the RAB2A and PRDX1 gene in 80 and 68 % of the tested clinical cases, respectively.
25818297 Pin1/Rab2A/Erk drives BCSC expansion and tumorigenicity, suggesting potential drug targets.
24700772 As a result of the translocations, RAB2A-PLAG1, the constitutively active promoter of the partner gene drives the ectopic expression of PLAG1.
24251537 first X-ray crystal structure of RicA to 2.7 A resolution and have quantified the affinity of RicA binding to human Rab2 in its GDP-bound and nucleotide-free forms
21501366 The authors identified a specific interaction between the human small GTPase Rab2 and a Brucella spp. protein named RicA.
20308991 The results of this study provided that RAB2A and SLC38A1, were associated with the density of calbindin-positive neurons and the number of perineuronal oligodendrocytes in psychiatric disorders.
20308991 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of RAB2A, member RAS oncogene family (RAB2A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187231 ICA69 as a novel Rab2 effector and its role in regulating the early transport of insulin secretory granule proteins
17716866 These data demonstrate that Rab2 and Rab6 differentially influence anterograde transport and signaling of GPCRs.
14570876 Rab2 interacts directly with atypical protein kinase C iota/lambda and inhibits aPKCiota/lambda-dependent GADPH phosphorylation

AA Sequence

MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS      1 - 70
ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE     71 - 140
HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG    141 - 210
CC                                                                        211 - 212
//

Text Mined References (46)

PMID Year Title
26938441 2016 De Novo Synonymous Mutations in Regulatory Elements Contribute to the Genetic Etiology of Autism and Schizophrenia.
26249043 2015 RAB2A Polymorphism impacts prefrontal morphology, functional connectivity, and working memory.
26159854 2015 Identification of RAB2A and PRDX1 as the potential biomarkers for oral squamous cell carcinoma using mass spectrometry-based comparative proteomic approach.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25818297 2015 The Rab2A GTPase promotes breast cancer stem cells and tumorigenesis via Erk signaling activation.
25416956 2014 A proteome-scale map of the human interactome network.
24700772 2014 Identification of COL3A1 and RAB2A as novel translocation partner genes of PLAG1 in lipoblastoma.
24251537 2013 Molecular structure of the Brucella abortus metalloprotein RicA, a Rab2-binding virulence effector.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21501366 2011 Identification of a Brucella spp. secreted effector specifically interacting with human small GTPase Rab2.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20308991 2011 Integrative genome-wide association analysis of cytoarchitectural abnormalities in the prefrontal cortex of psychiatric disorders.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18187231 2008 ICA69 is a novel Rab2 effector regulating ER-Golgi trafficking in insulinoma cells.
17897319 2007 Integral and associated lysosomal membrane proteins.
17716866 2007 Regulation of anterograde transport of adrenergic and angiotensin II receptors by Rab2 and Rab6 GTPases.
17684057 2007 Analysis of GTPase-activating proteins: Rab1 and Rab43 are key Rabs required to maintain a functional Golgi complex in human cells.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16034420 2005 Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485821 2004 Glyceraldehyde-3-phosphate dehydrogenase interacts with Rab2 and plays an essential role in endoplasmic reticulum to Golgi transport exclusive of its glycolytic activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14570876 2003 Rab2 interacts directly with atypical protein kinase C (aPKC) iota/lambda and inhibits aPKCiota/lambda-dependent glyceraldehyde-3-phosphate dehydrogenase phosphorylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376746 2002 Molecular cloning and characterization of a novel human Rab ( Rab2B) gene.
11739401 2001 A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic.
10996854 2000 Impairment of bile salt-dependent lipase secretion in human pancreatic tumoral SOJ-6 cells.
10512627 1999 General role of GDP dissociation inhibitor 2 in membrane release of Rab proteins: modulations of its functional interactions by in vitro and in vivo structural modifications.
9792283 1998 Small GTP-binding proteins in human endothelial cells.
9110174 1997 Large-scale concatenation cDNA sequencing.
8910601 1996 Rab2 is essential for the maturation of pre-Golgi intermediates.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
3057444 1988 Nucleotide sequence of a new YPT1-related human cDNA which belongs to the ras gene superfamily.
2501306 1989 The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.
2493636 1989 Nucleotide sequence of a rat cDNA: rab1B, encoding a rab1-YPT related protein.
1648736 1991 Isoprenoid modification of rab proteins terminating in CC or CXC motifs.