Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.09
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.068 2.5e-02
osteosarcoma 1.356 1.3e-03
ovarian cancer -1.600 4.5e-05
psoriasis -1.300 2.2e-04

Gene RIF (6)

AA Sequence

MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIG      1 - 70
GQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIK     71 - 140
PEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTV    141 - 210
NPPRSSMCAVQ                                                               211 - 221
//

Text Mined References (18)

PMID Year Title