Property Summary

NCBI Gene PubMed Count 42
PubMed Score 41.29
PubTator Score 34.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -4.800 1.7e-07
astrocytoma -1.900 2.6e-18
posterior fossa group B ependymoma -4.100 2.3e-13
oligodendroglioma -3.000 1.0e-02
psoriasis 1.400 1.5e-08
glioblastoma multiforme -2.200 2.9e-22
medulloblastoma -4.300 4.8e-08
cystic fibrosis 4.027 1.5e-08
atypical teratoid / rhabdoid tumor -2.800 4.7e-04
medulloblastoma, large-cell -3.800 1.1e-03
tuberculosis 1.600 7.6e-06
intraductal papillary-mucinous adenoma (... 3.000 7.7e-04
intraductal papillary-mucinous carcinoma... 2.200 8.1e-03
intraductal papillary-mucinous neoplasm ... 2.300 2.8e-02
lung cancer -3.500 3.6e-06
pancreatic cancer 1.300 4.8e-04
interstitial cystitis -1.400 2.8e-03
adult high grade glioma -2.100 8.1e-03
pilocytic astrocytoma -1.900 2.1e-03
Endometriosis -1.671 1.5e-02
lung carcinoma -2.500 2.0e-24
spina bifida -1.331 4.3e-02
Pick disease -1.900 4.7e-02
ductal carcinoma in situ 2.300 4.6e-03
invasive ductal carcinoma 2.400 9.2e-03
ovarian cancer -4.800 6.1e-12
Breast cancer -1.500 3.4e-05
pituitary cancer 1.700 1.6e-02
facioscapulohumeral dystrophy -2.200 6.4e-04

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (21)

PMID Text
26913720 MiR-193a-3p and miR-193a-5p play important roles in osteosarcoma metastasis through down-regulation of the Rab27B and SRR genes and therefore may serve as useful biomarkers for the diagnosis of osteosarcoma
26845357 These data indicate that Rab27B is involved at a different steps of zymogen granule maturation and secretion, which is distinct from that of Rab3D.
26760980 decreased expression of Rab27A and Rab27B, especially Rab27A, closely correlated with tumor progression and are valuable prognostic indicators in colorectal cancer patients.
26418905 Data indicate that a significant correlation between rab GTP-binding protein (RAB27B) and p53 tumor suppressor protein (p53) expression was observed.
26348397 Data indicate that the secretion of microRNA miR-143, depends on rab GTP-binding proteins Rab7a and Rab27b.
26165699 Decreased invasion partly resulted from reduced expression and activation of MMP-9 after Rab27b knockdown. Downregulation of Rab27b also suppressed tumor growth in vivo.
25382899 Rab27B nuclear expression is correlated with several clinicopathological features of GIST patients, and it may serve as an unfavorable prognostic marker.
25261234 Silencing of the exocytotic RAB family members RAB27A or RAB27B halted miR23b and miR921 secretion and reduced cellular invasion.
23665896 Experimental data are reviewed with a focus on the secretory Rab27 family of small GTPases and their implications in cancer progression.
23390068 inhibiting V-ATPase activity by interfering agents and drugs might be an effective strategy for blocking Rab27B-dependent proinvasive secretory vesicle trafficking in ERalpha-positive breast cancer patients
23217148 findings suggest that overexpression of Rab27B in BC coincides with lymph node metastasis and acquisition of a poor prognostic phenotype
22349512 These results suggest that Rab27b negatively regulates the cell surface expression of c-kit via secretion of SCF and that ligation of SCF leads to the endolysosomal degradation system of c-kit.
21304180 in human breast cancer specimens, the presence of Rab27B protein proved to be associated with a low degree of differentiation and the presence of lymph node metastasis in ER-positive breast cancer
21198862 were unable to find any mutation in the coding sequence of RAB27B in five patients suffering from different types of platelet delta-storage pool deficiency
20888820 Rab27b is associated with tubulovesicle membranes in the parietal cell and Rab27b may play a role in stimulation-associated membrane recruitment and gastric acid secretion.
20484105 Rab27B regulates invasive growth and metastasis in ER-positive breast cancer cell lines, and increased expression is associated with poor prognosis in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18478159 During primate spermiogenesis, dynein, myosin Va, MyRIP and Rab27b that compose microtubule-based and actin-based vesicle transport systems are actually present in the manchette and might possibly be involved in intramanchette transport.
12122117 Rab27b is functionally redundant with Rab27a and the pathogenesis of Griscelli syndrome is determined by the relative expression of Rab27a and Rab27b in specialized cell types.
11178108 Chromosomal mapping and gene structure of the RAB27B gene.

AA Sequence

MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHL      1 - 70
QLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQ     71 - 140
REVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEK    141 - 210
PPEKKCIC                                                                  211 - 218
//

Text Mined References (45)

PMID Year Title
26913720 2016 MiR-193a-3p and miR-193a-5p suppress the metastasis of human osteosarcoma cells by down-regulating Rab27B and SRR, respectively.
26845357 2016 Genetic deletion of Rab27B in pancreatic acinar cells affects granules size and has inhibitory effects on amylase secretion.
26760980 2015 Decreased expression of Rab27A and Rab27B correlates with metastasis and poor prognosis in colorectal cancer.
26418905 2016 Correlation Between RAB27B and p53 Expression and Overall Survival in Pancreatic Cancer.
26348397 2015 Rab7a and Rab27b control secretion of endothelial microRNA through extracellular vesicles.
26165699 2015 Hypomethylated Rab27b is a progression-associated prognostic biomarker of glioma regulating MMP-9 to promote invasion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25382899 2014 Prognostic value of Rab27B nuclear expression in gastrointestinal stromal tumors.
25261234 2014 Cellular disposal of miR23b by RAB27-dependent exosome release is linked to acquisition of metastatic properties.
23665896 2013 Rab27 GTPases distribute extracellular nanomaps for invasive growth and metastasis: implications for prognosis and treatment.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23390068 2013 Vacuolar H+ ATPase expression and activity is required for Rab27B-dependent invasive growth and metastasis of breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23217148 2012 Overexpression of the secretory small GTPase Rab27B in human breast cancer correlates closely with lymph node metastasis and predicts poor prognosis.
22349512 2012 Rab27b regulates c-kit expression by controlling the secretion of stem cell factor.
21304180 2010 The secretory small GTPase Rab27B as a marker for breast cancer progression.
21269460 2011 Initial characterization of the human central proteome.
21198862 2011 Absence of mutation in the RAB27B gene in patients with platelet delta-storage pool deficiency.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20888820 2011 Rab27b localizes to the tubulovesicle membranes of gastric parietal cells and regulates acid secretion.
20484105 2010 Effect of the secretory small GTPase Rab27B on breast cancer growth, invasion, and metastasis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19966785 2010 Rab27a and Rab27b control different steps of the exosome secretion pathway.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18478159 2008 Intramanchette transport during primate spermiogenesis: expression of dynein, myosin Va, motor recruiter myosin Va, VIIa-Rab27a/b interacting protein, and Rab27b in the manchette during human and monkey spermiogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16880209 2006 Constitutive GDP/GTP exchange and secretion-dependent GTP hydrolysis activity for Rab27 in platelets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15357836 2004 Rab27b is up-regulated in human Griscelli syndrome type II melanocytes and linked to the actin cytoskeleton via exon F-Myosin Va transcripts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699162 2004 Munc13-4 is a GTP-Rab27-binding protein regulating dense core granule secretion in platelets.
12907454 2003 A role for Rab27b in NF-E2-dependent pathways of platelet formation.
12578829 2003 Distinct Rab binding specificity of Rim1, Rim2, rabphilin, and Noc2. Identification of a critical determinant of Rab3A/Rab27A recognition by Rim2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12122117 2002 Functional redundancy of Rab27 proteins and the pathogenesis of Griscelli syndrome.
11956164 2002 Involvement of Rab27b in the regulated secretion of pituitary hormones.
11856727 2002 Slac2-a/melanophilin, the missing link between Rab27 and myosin Va: implications of a tripartite protein complex for melanosome transport.
11178108 2001 Chromosomal mapping, gene structure and characterization of the human and murine RAB27B gene.
9110174 1997 Large-scale concatenation cDNA sequencing.
9066979 1997 Molecular cloning and characterization of rab27a and rab27b, novel human rab proteins shared by melanocytes and platelets.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
2507536 1989 Purification, identification, and characterization of two GTP-binding proteins with molecular weights of 25,000 and 21,000 in human platelet cytosol. One is the rap1/smg21/Krev-1 protein and the other is a novel GTP-binding protein.
1445946 1992 Purification and characterization of a low M(r) GTP-binding protein, c25KG, from human platelet membranes.