Property Summary

Ligand Count 1
NCBI Gene PubMed Count 118
PubMed Score 204.91
PubTator Score 170.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Griscelli syndrome type 2 12 0.0 0.0
Disease Target Count Z-score Confidence
Griscelli syndrome 24 7.497 3.7

Expression

Gene RIF (79)

AA Sequence

MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL      1 - 70
QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ     71 - 140
RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL    141 - 210
SEEKEKGACGC                                                               211 - 221
//

Text Mined References (123)

PMID Year Title