Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.10
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.500 1.8e-02
astrocytic glioma -1.600 2.0e-03
Astrocytoma, Pilocytic -1.100 4.4e-03
atypical teratoid / rhabdoid tumor -2.900 5.3e-11
Breast cancer 1.300 6.0e-05
ductal carcinoma in situ 1.800 7.0e-03
ependymoma -1.600 7.1e-03
gastric carcinoma -1.500 5.0e-02
glioblastoma -1.800 6.0e-06
group 4 medulloblastoma -1.300 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.7e-02
invasive ductal carcinoma 2.500 3.3e-03
malignant mesothelioma 1.300 1.6e-06
medulloblastoma, large-cell -1.800 1.7e-03
oligodendroglioma -1.200 2.8e-02
ovarian cancer 1.100 3.3e-09
pancreatic cancer -1.300 5.5e-04
Pick disease -1.500 4.0e-04
primary pancreatic ductal adenocarcinoma -1.230 5.4e-03
primary Sjogren syndrome -1.600 1.3e-03
primitive neuroectodermal tumor -2.400 1.0e-04
subependymal giant cell astrocytoma -2.325 1.7e-02

Gene RIF (6)

AA Sequence

MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVG      1 - 70
DSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHAL     71 - 140
LLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKT    141 - 210
GLNVDLAFTAIAKELKQRSMKAPSEPRFRLHDYVKREGRGASCCRP                            211 - 256
//

Text Mined References (15)

PMID Year Title