Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.45
PubTator Score 20.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.451 2.4e-02
psoriasis -1.400 2.1e-04
osteosarcoma -1.049 9.8e-04
glioblastoma 1.200 1.8e-02
atypical teratoid / rhabdoid tumor -1.600 1.2e-04
medulloblastoma -1.400 1.2e-05
medulloblastoma, large-cell -2.300 4.7e-05
intraductal papillary-mucinous carcinoma... 1.100 1.3e-02
Breast cancer 3.300 2.6e-02
aldosterone-producing adenoma -1.328 1.0e-02
Pick disease -1.100 7.9e-04
ovarian cancer -1.600 2.5e-06

Gene RIF (13)

PMID Text
26382657 our results demonstrated that miR-203 act as a tumor suppressor miRNA through regulating RAB22A expression and suggested its involvement in osteosarcoma progression and carcinogenesis.
26344766 Data show that Rab22a- and Rab5a-driven phagosomal uptake is a crucial step in the vesicular cascade that leads to elimination of spirochetes by macrophages.
26041286 Vaccinia virus traffics to early endosomes, where recycling endosome markers Rab11 and Rab22 are recruited to participate in subsequent virus trafficking prior to virus core uncoating in the cytoplasm.
25550792 Re-expression of miR-193b in breast cancer cell lines decreased DNAJC13 (HPS40) and RAB22A expression, providing a mechanism by which mir193-b acts as a tumor suppressor.
25460499 these results demonstrate that miR-373 suppresses epithelial ovarian cancer invasion and metastasis by directly targeting Rab22a gene
25429829 miR-204-5p acts as a tumor suppressor in gastric cancer through inhibiting USP47 and RAB22A.
25294901 miR-204-5p acts as a tumor suppressor in colorectal cancer through inhibiting RAB22A and reveal RAB22A to be a new oncogene and prognostic factor for colorectal cancer.
24938788 Exposure of human breast cancer cells to hypoxia augments microvesicle (MVs) shedding that is mediated by the HIF-dependent expression of the small GTPase RAB22A, which colocalizes with budding MVs at the cell surface.
19759177 Data report the identification of Rab22 as a binding site on early endosomes for direct recruitment of Rabex-5 and activation of Rab5, establishing a Rab22-Rab5 signaling relay to promote early endosome fusion.
16537905 Rab22a controls the transport of the transferrin receptor from sorting to recycling endosomes.
15748882 Rab22a can affect the trafficking from endosomes to the Golgi apparatus probably by promoting fusion among endosomes and impairing the proper segregation of membrane domains required for targeting to the trans-Golgi network (TGN).
15181155 Rab22a regulates different steps in the recycling of cargo protein that has entered the cell independently of clathrin.
11870209 Rab22a may regulate the dynamic interactions of endosomal compartments and it may be involved in the communication between the biosynthetic and early endocytic pathways.

AA Sequence

MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL      1 - 70
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI     71 - 140
HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC                    141 - 194
//

Text Mined References (32)

PMID Year Title
26382657 2015 miR-203 Acts as a Tumor Suppressor Gene in Osteosarcoma by Regulating RAB22A.
26344766 2015 ER-Coordinated Activities of Rab22a and Rab5a Drive Phagosomal Compaction and Intracellular Processing of Borrelia burgdorferi by Macrophages.
26041286 2015 Intracellular Transport of Vaccinia Virus in HeLa Cells Requires WASH-VPEF/FAM21-Retromer Complexes and Recycling Molecules Rab11 and Rab22.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25550792 2014 Tumor suppressive microRNA-193b promotes breast cancer progression via targeting DNAJC13 and RAB22A.
25460499 2014 MiR-373 targeting of the Rab22a oncogene suppresses tumor invasion and metastasis in ovarian cancer.
25429829 2015 MicroRNA-204-5p inhibits gastric cancer cell proliferation by downregulating USP47 and RAB22A.
25416956 2014 A proteome-scale map of the human interactome network.
25294901 2014 miR-204-5p inhibits proliferation and invasion and enhances chemotherapeutic sensitivity of colorectal cancer cells by downregulating RAB22A.
24938788 2014 Hypoxia-inducible factors and RAB22A mediate formation of microvesicles that stimulate breast cancer invasion and metastasis.
24466322 2014 Human liver cell trafficking mutants: characterization and whole exome sequencing.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21849477 2011 Rab22 controls NGF signaling and neurite outgrowth in PC12 cells.
21419809 2011 Rin-like, a novel regulator of endocytosis, acts as guanine nucleotide exchange factor for Rab5a and Rab22.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
19759177 2009 Rabex-5 is a Rab22 effector and mediates a Rab22-Rab5 signaling cascade in endocytosis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16537905 2006 Rab22a regulates the sorting of transferrin to recycling endosomes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15748882 2005 Overexpression of Rab22a hampers the transport between endosomes and the Golgi apparatus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15181155 2004 Rab22a regulates the recycling of membrane proteins internalized independently of clathrin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11870209 2002 The small GTPase Rab22 interacts with EEA1 and controls endosomal membrane trafficking.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10887961 2000 Expression of Rab small GTPases in epithelial Caco-2 cells: Rab21 is an apically located GTP-binding protein in polarised intestinal epithelial cells.
10329441 1999 Interaction cloning and characterization of the cDNA encoding the human prenylated rab acceptor (PRA1).
9918381 1998 Cloning of Rab GTPases expressed in human skeletal muscle: studies in insulin-resistant subjects.