Property Summary

NCBI Gene PubMed Count 36
PubMed Score 22.65
PubTator Score 20.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.121 2.4e-04
medulloblastoma, large-cell -1.500 1.4e-04
hereditary spastic paraplegia -1.136 1.7e-02
tuberculosis -1.400 8.3e-06
lung cancer -1.100 1.2e-03
ovarian cancer 2.100 5.6e-03
dermatomyositis 1.200 2.1e-03

 IMPC Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (6)

PMID Text
25648148 Starvation-induced MTMR13 and RAB21 activity regulates VAMP8 to promote autophagosome-lysosome fusion.
24477653 High RAB21 expression is associated with glioma.
22525675 Taken together, these data suggest that Rab21 plays a negative role in the EGF-mediated MAPK signaling pathway. Overexpression of Rab21 attenuated EGF-mediated mitogen-activated protein kinase (MAPK) signaling by inducing EGFR degradation.
19745841 show that TI-VAMP interacts with the Vps9 domain and ankyrin-repeat-containing protein Varp, a guanine nucleotide exchange factor of the small GTPase Rab21, through a specific domain herein called the interacting domain.
18804435 Results show that targeted trafficking of integrins to and from the cleavage furrow is required for successful cytokinesis, and that this is regulated by Rab21.
16754960 Rab21 (and Rab5) associate with the cytoplasmic domains of alpha-integrin chains, and their expression influences the endo/exocytic traffic of integrins. This function of Rab21 is dependent on its GTP/GDP cycle and proper membrane targeting

AA Sequence

MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNL      1 - 70
AIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER     71 - 140
HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD    141 - 210
EPQAQTSGGGCCSSG                                                           211 - 225
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25648148 2015 Starvation-induced MTMR13 and RAB21 activity regulates VAMP8 to promote autophagosome-lysosome fusion.
24477653 2014 miR-200b as a prognostic factor targets multiple members of RAB family in glioma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22705394 2012 A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery.
22525675 2012 Rab21 attenuates EGF-mediated MAPK signaling through enhancing EGFR internalization and degradation.
22120710 2012 Cytokinesis failure due to derailed integrin traffic induces aneuploidy and oncogenic transformation in vitro and in vivo.
21768288 2011 Competitive binding of Rab21 and p120RasGAP to integrins regulates receptor traffic and migration.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19953096 2010 A chemical biology screen reveals a role for Rab21-mediated control of actomyosin contractility in fibroblast-driven cancer invasion.
19745841 2009 Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth.
19418559 2009 Rabs and cancer cell motility.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18804435 2008 Integrin trafficking regulated by Rab21 is necessary for cytokinesis.
18477474 2008 Varp interacts with Rab38 and functions as its potential effector.
18318119 [Multiadaptor 4.1 and RanBP9 protein family members as putative interaction partners for VARP, a Rab21 GTPase guanine nucleotide exchange factor].
18162182 2008 Characterization of Rab21-positive tubular endosomes induced by PI3K inhibitors.
17581628 2007 Structure of the APPL1 BAR-PH domain and characterization of its interaction with Rab5.
17450153 2007 Structural basis for Rab GTPase activation by VPS9 domain exchange factors.
17312329 2007 Differential gene expression patterns and interaction networks in BCR-ABL-positive and -negative adult acute lymphoblastic leukemias.
16754960 2006 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.
16525121 2006 Varp is a Rab21 guanine nucleotide exchange factor and regulates endosome dynamics.
16381901 2006 The LIFEdb database in 2006.
16034420 2005 Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
15649134 2005 Early endocytic Rabs: functional prediction to functional characterization.
15561770 2004 A role for the small GTPase Rab21 in the early endocytic pathway.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10887961 2000 Expression of Rab small GTPases in epithelial Caco-2 cells: Rab21 is an apically located GTP-binding protein in polarised intestinal epithelial cells.
9918381 1998 Cloning of Rab GTPases expressed in human skeletal muscle: studies in insulin-resistant subjects.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.