Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.36
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma -1.100 1.7e-04
malignant mesothelioma 3.100 5.4e-08
esophageal adenocarcinoma 1.600 1.8e-02
cutaneous lupus erythematosus 1.300 8.8e-03
glioblastoma 1.700 1.2e-02
adrenocortical carcinoma -1.821 4.2e-04
non-small cell lung cancer -1.102 1.3e-10
lung cancer -2.600 4.5e-05
colon cancer 1.100 1.3e-02
adult high grade glioma 1.100 8.9e-03
invasive ductal carcinoma 1.020 5.9e-03
ovarian cancer 1.300 2.2e-04
pituitary cancer -1.800 5.5e-07

 GO Function (1)

Gene RIF (3)

PMID Text
23874396 TdIF1 associates with the RAB20 promoter, and RAB20 gene transcription is reduced in TdIF1-knocked-down cells, suggesting that TdIF1 stimulates RAB20 gene transcription.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649179 Regulates connexin 43 intracellular transport.

AA Sequence

MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYC      1 - 70
RGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDR     71 - 140
VSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRA    141 - 210
ERPSHTVDISSHKPPKRTRSGCCA                                                  211 - 234
//

Text Mined References (11)

PMID Year Title
23874396 2013 TdIF1 recognizes a specific DNA sequence through its Helix-Turn-Helix and AT-hook motifs to regulate gene transcription.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18649179 2008 Identification of rab20 as a potential regulator of connexin 43 trafficking.
16613320 2006 Characterization of human Rab20 overexpressed in exocrine pancreatic carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.
7706395 1994 Cloning and subcellular localization of novel rab proteins reveals polarized and cell type-specific expression.