Property Summary

NCBI Gene PubMed Count 39
PubMed Score 36.31
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytoma 1.100 2.6e-03

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (14)

PMID Text
26977884 RAB1B localization to the Golgi.
25970785 RAB1B acts as a metastasis suppressor in triple-negative breast cancer by regulating the TGF-beta/SMAD signaling pathway and RAB1B may serve as a biomarker of prognosis and response to anti-tumor therapeutics for patients with triple-negative breast cancer.
23325787 Our results show, for the first time, that changes in Rab1b levels modulate gene transcription and strongly suggest that a Rab1b increase is required to elicit a secretory response.
23288104 The crystal structure of the Rab1b-LepB complex.
23236136 The detailed molecular reaction mechanism of a complex between human Rab and RabGAP at the highest possible spatiotemporal resolution and in atomic detail, is described.
23188820 results indicate that the cellular localization of MTMR6 is regulated by Rab1B in the early secretory and autophagic pathways
22260459 Overexpression of TBC1D20, RAB1A, or RAB1B results in abnormal HIV-1 gp41 migration, suggesting that a precise regulation of the RAB1/TBC1D20 axis is necessary for proper HIV-1 gp41 processing
21680502 Rab1a/b and Rab43, are important for herpes simplex virus 1 virion assembly
21093099 Rab1b is a key regulatory component of COPII dynamics and function.
20980813 Antibacterial autophagy occurs at omegasomes and reveal that the Rab1 GTPase plays a crucial role in mammalian autophagy.
20164217 The authors demonstrate that Rab1b-activated GBF1 and ARF1 are involved in Ebolavirus virion formation, suggesting that both the COPII and COPI transport systems play a role in Ebolavirus VP40-mediated particle formation.
18187620 Knockdown of RAB1B, member RAS oncogene family (RAB1B) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17947549 findings show that SidM from Legionella pneumophila could act as both a GDP-GTP exchange factor and GDP-dissociation inhibitor-displacement factor (GDF) for Rab1
17429068 These data support a model where Rab1b-GTP induces GBF1 recruitment at the ERES interface and at the Golgi complex where it is required for COPII/COPI exchange or COPI vesicle formation, respectively.

AA Sequence

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF      1 - 70
RTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFA     71 - 140
DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC             141 - 201
//

Text Mined References (49)

PMID Year Title
26977884 2016 PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion.
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
25970785 2015 Loss of RAB1B promotes triple-negative breast cancer metastasis by activating TGF-?/SMAD signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23325787 2013 Rab1b overexpression modifies Golgi size and gene expression in HeLa cells and modulates the thyrotrophin response in thyroid cells in culture.
23288104 2013 Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
23236136 2012 Catalytic mechanism of a mammalian Rab·RabGAP complex in atomic detail.
23188820 2013 Phosphatidylinositol 3-phosphatase myotubularin-related protein 6 (MTMR6) is regulated by small GTPase Rab1B in the early secretory and autophagic pathways.
22307087 2012 Reversible phosphocholination of Rab proteins by Legionella pneumophila effector proteins.
22158903 2011 Legionella pneumophila regulates the small GTPase Rab1 activity by reversible phosphorylcholination.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
21734656 2011 Legionella pneumophila SidD is a deAMPylase that modifies Rab1.
21680813 2011 De-AMPylation of the small GTPase Rab1 by the pathogen Legionella pneumophila.
21680502 2011 Analysis of Rab GTPase-activating proteins indicates that Rab1a/b and Rab43 are important for herpes simplex virus 1 secondary envelopment.
21378754 2011 A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1.
21093099 2011 Role of Rab1b in COPII dynamics and function.
20980813 2011 Antibacterial autophagy occurs at PI(3)P-enriched domains of the endoplasmic reticulum and requires Rab1 GTPase.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20651120 2010 The Legionella effector protein DrrA AMPylates the membrane traffic regulator Rab1b.
20545908 2010 Autophagosome formation depends on the small GTPase Rab1 and functional ER exit sites.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20164217 2010 Role of the GTPase Rab1b in ebolavirus particle formation.
20064470 2009 RabGDI displacement by DrrA from Legionella is a consequence of its guanine nucleotide exchange activity.
17947549 2007 A bifunctional bacterial protein links GDI displacement to Rab1 activation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17429068 2007 Rab1b interacts with GBF1 and modulates both ARF1 dynamics and COPI association.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
15796781 2005 Identification and characterization of Iporin as a novel interaction partner for rab1.
15694364 2005 The MICAL proteins and rab1: a possible link to the cytoskeleton?
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12802079 2003 COPI recruitment is modulated by a Rab1b-dependent mechanism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051767 2002 Intracellular membrane trafficking pathways in bone-resorbing osteoclasts revealed by cloning and subcellular localization studies of small GTP-binding rab proteins.
11389151 2001 Membrane targeting of a Rab GTPase that fails to associate with Rab escort protein (REP) or guanine nucleotide dissociation inhibitor (GDI).
11306556 2001 The Golgi matrix protein GM130: a specific interacting partner of the small GTPase rab1b.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10493955 1999 Inactive and active mutants of rab1b are not tightly integrated into target membranes.
9437002 1998 The putative "switch 2" domain of the Ras-related GTPase, Rab1B, plays an essential role in the interaction with Rab escort protein.
9030196 1997 RAB GTPases expressed in human melanoma cells.
8836150 1996 Prenylation of a Rab1B mutant with altered GTPase activity is impaired in cell-free systems but not in intact mammalian cells.
7592724 1995 Rab7 and Rab9 are recruited onto late endosomes by biochemically distinguishable processes.
1918138 1991 Rab1b regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments.