Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.89
PubTator Score 3.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.100 2.2e-06
astrocytic glioma -1.600 3.9e-03
Astrocytoma, Pilocytic -1.400 3.8e-07
atypical teratoid / rhabdoid tumor -2.300 9.1e-12
Down syndrome -1.100 6.4e-04
ductal carcinoma in situ 1.400 9.9e-04
ependymoma -2.000 3.2e-03
fibroadenoma 1.800 2.8e-02
glioblastoma -1.700 6.4e-09
group 3 medulloblastoma -1.200 8.4e-03
interstitial cystitis -1.200 4.8e-03
intraductal papillary-mucinous carcinoma... 1.600 2.2e-02
invasive ductal carcinoma 1.400 5.1e-03
lung cancer 1.200 6.4e-03
malignant mesothelioma 1.300 2.4e-06
medulloblastoma, large-cell -2.800 6.3e-07
non diabetic and post-ischemic heart fai... -1.400 2.4e-03
oligodendroglioma -1.400 1.5e-02
osteosarcoma 1.841 2.2e-06
ovarian cancer 1.100 6.0e-04
Pick disease -1.300 1.4e-03
primary Sjogren syndrome -1.200 3.1e-02
primitive neuroectodermal tumor -1.400 6.2e-04
psoriasis 1.400 2.2e-04
type II diabetes mellitus and post-ische... -1.300 3.0e-02

Gene RIF (11)

AA Sequence

MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERY      1 - 70
QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLA     71 - 140
KEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELEGLRMRASNELALAELEEEEGKPEGPANSSKTC    141 - 210
WC                                                                        211 - 212
//

Text Mined References (26)

PMID Year Title