Property Summary

NCBI Gene PubMed Count 46
PubMed Score 28.17
PubTator Score 30.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.106 4.1e-03
psoriasis -1.200 5.6e-03
osteosarcoma 2.169 5.7e-07
astrocytoma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor -1.100 2.1e-04
medulloblastoma, large-cell -1.100 7.2e-04
intraductal papillary-mucinous adenoma (... 1.200 1.9e-04
intraductal papillary-mucinous carcinoma... 1.100 8.9e-04
colon cancer -1.100 3.0e-02
sonic hedgehog group medulloblastoma -1.200 3.8e-04
Pick disease 1.200 1.3e-04
ovarian cancer 2.500 2.6e-07

Protein-protein Interaction (9)

Gene RIF (14)

PMID Text
26032412 We find that Rab14 indeed binds to RCP, albeit with reduced affinity relative to conventional Rab11-FIP and Rab25-FIP complexes. However, in vivo, Rab11 recruits RCP onto biological membranes.
25694446 PKCiota binds to Rab14 and that PKCiota requires Rab14 for its correct distribution in cells. As with Rab14, PKCiota protects claudin-2 from lysosomal degradation and, in consequence, modulates epithelial barrier.
25312678 RAB14 is a direct target of both MIR144 and MIR451. As MIR144 and MIR451 expression increased during human erythropoiesis, RAB14 protein expression decreased. RAB14 as a novel physiological inhibitor of human erythropoiesis.
25201065 the miR-451/RAB14 interaction plays an important role in the enhancement of radiosensitivity in NPC cells.
24006491 Data indicate that myosin Va interacted with multiple new Rab subfamilies including Rab6, Rab14 and Rab39B.
23615442 Data indicate taht the parasitophorous vacuole (PV), marked with Rab14, Rab30, or Rab43, colocalize with host-derived sphingolipids in the vacuolar space.
23606746 Rab5a, Rab8a and Rab14 are major regulators of MT1-MMP trafficking and invasive migration of primary human macrophages.
23592992 findings support a model for HIV-1 Env incorporation in which specific targeting to the particle assembly microdomain on the plasma membrane is mediated by FIP1C and Rab14
23592992 The interaction of RAB11-FIP1C with RAB14 is required for incorporation of HIV-1 Env (gp120/gp41) into virions
22595670 FAM116 and Rab14 therefore define an endocytic recycling pathway needed for ADAM protease trafficking and regulation of cell-cell junctions.
21358675 Data suggest that targeting with the miR-451/RAB14 interaction might serve as a novel therapeutic application to treat NSCLC patients.
21124879 Data show that Rab14 facilitates the delivery of sphingolipids required for bacterial development and replication from the Golgi to chlamydial inclusions.
20534812 These findings suggest that Rab14 and Rab4 act sequentially, together with RUFY1.
19702578 identifies the class I Rab11-FIPs as the first putative effector proteins for the Rab14 GTPase

AA Sequence

MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ      1 - 70
ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK     71 - 140
QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR    141 - 210
EGCGC                                                                     211 - 215
//

Text Mined References (53)

PMID Year Title
26032412 2015 Structure-Function Analyses of the Interactions between Rab11 and Rab14 Small GTPases with Their Shared Effector Rab Coupling Protein (RCP).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25694446 2015 PKC? interacts with Rab14 and modulates epithelial barrier function through regulation of claudin-2 levels.
25416956 2014 A proteome-scale map of the human interactome network.
25312678 2015 MIR144 and MIR451 regulate human erythropoiesis via RAB14.
25201065 2014 MiR-451 increases radiosensitivity of nasopharyngeal carcinoma cells by targeting ras-related protein 14 (RAB14).
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23615442 2013 Toxoplasma gondii salvages sphingolipids from the host Golgi through the rerouting of selected Rab vesicles to the parasitophorous vacuole.
23606746 2013 A specific subset of RabGTPases controls cell surface exposure of MT1-MMP, extracellular matrix degradation and three-dimensional invasion of macrophages.
23592992 2013 Rab11-FIP1C and Rab14 direct plasma membrane sorting and particle incorporation of the HIV-1 envelope glycoprotein complex.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22595670 2012 Rab14 and its exchange factor FAM116 link endocytic recycling and adherens junction stability in migrating cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21358675 2011 MicroRNA-451 functions as a tumor suppressor in human non-small cell lung cancer by targeting ras-related protein 14 (RAB14).
21269460 2011 Initial characterization of the human central proteome.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
21124879 2010 Chlamydia trachomatis intercepts Golgi-derived sphingolipids through a Rab14-mediated transport required for bacterial development and replication.
20534812 2010 Functional cross-talk between Rab14 and Rab4 through a dual effector, RUFY1/Rabip4.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19702578 2009 Class I Rab11-family interacting proteins are binding targets for the Rab14 GTPase.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19116169 2009 Chaperone-assisted production of active human Rab8A GTPase in Escherichia coli.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16962593 2006 Rab14 is part of the early endosomal clathrin-coated TGN microdomain.
16902405 2006 Membrane targeting and activation of the Lowe syndrome protein OCRL1 by rab GTPases.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
16034420 2005 Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
15971998 2005 AS160, the Akt substrate regulating GLUT4 translocation, has a functional Rab GTPase-activating protein domain.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15004230 2004 Rab14 is involved in membrane trafficking between the Golgi complex and endosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790131 2002 Monitoring of gene expression by functional proteomics: response of human lung fibroblast cells to stimulation by endothelin-1.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11149929 2001 The phagosome proteome: insight into phagosome functions.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9792283 1998 Small GTP-binding proteins in human endothelial cells.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.