Property Summary

NCBI Gene PubMed Count 34
PubMed Score 26.18
PubTator Score 23.70

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (11)

Gene RIF (8)

PMID Text
27044746 the role of Rab13 as a potent driver of cancer progression.
26471730 Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65).
25713415 Disruption of Rab13-mediated trafficking dramatically limits the invasive behavior of epithelial cells in vitro and the growth and migration of highly invasive cancer cells in vivo.
22562557 It is suggested that Rab13 is associated with a putative secretory function in osteoclasts.
19885626 Rab13,VASP,and ZO-1 were found in apical tight junctions in normal epithelium but were dislocated to the basolateral position in patients with inactive Crohn's disease. In patients with ulcerative colitis,these tight junction proteins were not dislocated.
18779367 Rab13 regulates membrane trafficking between the trans-Golgi network (TGN) and recycling endosomes (RE).
17891173 Involved in epithelial cell scattering.
15528189 Rab13 specifically mediates the continuous endocytic recycling of occludin to the cell surface in both fibroblastic and epithelial cells

AA Sequence

MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERF      1 - 70
KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLA     71 - 140
REHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG           141 - 203
//

Text Mined References (39)

PMID Year Title
27044746 2016 Regulation of Cancer Cell Behavior by the Small GTPase Rab13.
26471730 2015 Phosphoproteomic screening identifies Rab GTPases as novel downstream targets of PINK1.
25713415 2015 DENND2B activates Rab13 at the leading edge of migrating cells and promotes metastatic behavior.
23772379 2013 Novel interaction of Rab13 and Rab8 with endospanins.
22562557 2012 Rab13 is upregulated during osteoclast differentiation and associates with small vesicles revealing polarized distribution in resorbing cells.
21795389 2011 MICAL-like1 mediates epidermal growth factor receptor endocytosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20008558 2010 Rab13 regulates neurite outgrowth in PC12 cells through its effector protein, JRAB/MICAL-L2.
19885626 2009 Dislocation of Rab13 and vasodilator-stimulated phosphoprotein in inactive colon epithelium in patients with Crohn's disease.
19273188 2009 Rab family small G proteins in regulation of epithelial apical junctions.
19116169 2009 Chaperone-assisted production of active human Rab8A GTPase in Escherichia coli.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18779367 2008 Rab13 regulates membrane trafficking between TGN and recycling endosomes in polarized epithelial cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18332111 2008 Involvement of actinin-4 in the recruitment of JRAB/MICAL-L2 to cell-cell junctions and the formation of functional tight junctions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17891173 2008 Involvement of Rab13 and JRAB/MICAL-L2 in epithelial cell scattering.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16525024 2006 JRAB/MICAL-L2 is a junctional Rab13-binding protein mediating the endocytic recycling of occludin.
16381901 2006 The LIFEdb database in 2006.
15971998 2005 AS160, the Akt substrate regulating GLUT4 translocation, has a functional Rab GTPase-activating protein domain.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15528189 2005 Rab13 mediates the continuous endocytic recycling of occludin to the cell surface.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15096524 2004 Rab13 regulates PKA signaling during tight junction assembly.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12058051 2002 The small GTPase Rab13 regulates assembly of functional tight junctions in epithelial cells.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9918381 1998 Cloning of Rab GTPases expressed in human skeletal muscle: studies in insulin-resistant subjects.
9712853 1998 The rod cGMP phosphodiesterase delta subunit dissociates the small GTPase Rab13 from membranes.
9605854 1997 Assignment of the Rab13 gene (RAB13) to human chromosome band 12q13 by in situ hybridization.
8375503 1993 Isoprenylation of Rab proteins possessing a C-terminal CaaX motif.
8294494 1994 A small rab GTPase is distributed in cytoplasmic vesicles in non polarized cells but colocalizes with the tight junction marker ZO-1 in polarized epithelial cells.