Property Summary

NCBI Gene PubMed Count 36
PubMed Score 27.38
PubTator Score 23.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERF      1 - 70
KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLA     71 - 140
REHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG           141 - 203
//

Text Mined References (42)

PMID Year Title