Property Summary

NCBI Gene PubMed Count 7
PubMed Score 13.92
PubTator Score 3.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 1.7e-02
atypical teratoid / rhabdoid tumor -2.200 5.5e-05
glioblastoma -2.000 1.0e-03
medulloblastoma -2.000 1.7e-04
medulloblastoma, large-cell -2.600 1.9e-06
primitive neuroectodermal tumor -1.200 3.7e-02
Rheumatoid arthritis 2.100 3.2e-03

Gene RIF (3)

AA Sequence

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA      1 - 70
CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI     71 - 140
DKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPL    141 - 210
DILRNELSNSILSLQPEPEIPPELPPPRPHVRCC                                        211 - 244
//

Text Mined References (15)

PMID Year Title