Property Summary

NCBI Gene PubMed Count 41
PubMed Score 33.34
PubTator Score 24.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma 1.100 1.1e-03
osteosarcoma 1.182 2.8e-05
limb girdle muscular dystrophy 2A -1.010 1.8e-03
primary pancreatic ductal adenocarcinoma 1.087 2.3e-02
tuberculosis and treatment for 6 months -2.200 3.5e-04
non-small cell lung cancer 1.024 2.0e-15
psoriasis 1.100 3.8e-42
Breast cancer 1.100 3.1e-17
invasive ductal carcinoma 1.300 7.5e-03
ovarian cancer 2.500 2.2e-05
pancreatic cancer 1.300 1.0e-02

Protein-protein Interaction (9)

Gene RIF (12)

PMID Text
26289115 The Anaplasma phagocytophilum surface protein, uridine monophosphate kinase, was identified as a guanine nucleotide-independent, Rab10-specific ligand.
26082458 the target gene RAB10 regulated by miRNA-369-3p, miRNA-30e-5p, miRNA-30e-3p, and miRNA-655 may play key role in the progression and development of AD.
25103239 Rab10 is a target of the GTPase-activating protein AS160, which is inhibited after phosphorylation by the protein kinase Akt.
24509846 Rab10 silencing increased the plasma membrane residence of HAS3, resulting in a significant increase of hyaluronan secretion and an enlarged cell surface HA coat, whereas Rab10 overexpression suppressed hyaluronan synthesis.
23263280 Rab10 regulates endoplasmic reticulum dynamics/morphology. Suggest that these dynamics could be coupled to phospholipid synthesis.
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related protein Rab-10 (RAB10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21454697 Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C
21070595 Rab10 and Rab8A are new cytoplasmic factors implicated in WPB biogenesis that play a role in generating granules that can rapidly respond to secretagogue
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20028485 Rab10, acting upstream of Rab5, plays a prominent role in phagolysosome formation and can modulate Mycobacterium-containing phagosomes maturation
19008234 a related Rab protein, Rab10, can interact with myosin Va, myosin Vb, and myosin Vc
15855153 Fibronectin 1 and RAB10 show elevated expression in uninvolved psoriatic epidermis.

AA Sequence

MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER      1 - 70
FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI     71 - 140
AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC              141 - 200
//

Text Mined References (47)

PMID Year Title
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26289115 2016 Anaplasma phagocytophilum Rab10-dependent parasitism of the trans-Golgi network is critical for completion of the infection cycle.
26082458 2016 Identification of Biomarkers Associated With Alzheimer's Disease by Bioinformatics Analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25103239 2014 A Rab10:RalA G protein cascade regulates insulin-stimulated glucose uptake in adipocytes.
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24509846 2014 Rab10-mediated endocytosis of the hyaluronan synthase HAS3 regulates hyaluronan synthesis and cell adhesion to collagen.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23263280 2013 Rab10 GTPase regulates ER dynamics and morphology.
22908308 2012 Rab10 and myosin-Va mediate insulin-stimulated GLUT4 storage vesicle translocation in adipocytes.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
21454697 2011 Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21248164 2011 Role of Rab GTPases in membrane traffic and cell physiology.
21070595 2011 A role for Rab10 in von Willebrand factor release discovered by an AP-1 interactor screen in C. elegans.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20576682 2010 Rab10 associates with primary cilia and the exocyst complex in renal epithelial cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20028485 2010 Rab10 regulates phagosome maturation and its overexpression rescues Mycobacterium-containing phagosomes maturation.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19570034 2009 GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation.
19116169 2009 Chaperone-assisted production of active human Rab8A GTPase in Escherichia coli.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19008234 2009 Alternative splicing in class V myosins determines association with Rab10.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641372 2006 Rab10 regulates membrane transport through early endosomes of polarized Madin-Darby canine kidney cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16154996 2005 Characterization of the role of the Rab GTPase-activating protein AS160 in insulin-regulated GLUT4 trafficking.
15971998 2005 AS160, the Akt substrate regulating GLUT4 translocation, has a functional Rab GTPase-activating protein domain.
15855153 2005 Identification and characterization of a novel, psoriasis susceptibility-related noncoding RNA gene, PRINS.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12578829 2003 Distinct Rab binding specificity of Rim1, Rim2, rabphilin, and Noc2. Identification of a critical determinant of Rab3A/Rab27A recognition by Rim2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450215 2002 Identification and characterization of nine novel human small GTPases showing variable expressions in liver cancer tissues.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9918381 1998 Cloning of Rab GTPases expressed in human skeletal muscle: studies in insulin-resistant subjects.
7688123 1993 Expression and localization of two low molecular weight GTP-binding proteins, Rab8 and Rab10, by epitope tag.