Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 1.100 1.9e-02
intraductal papillary-mucinous neoplasm ... 1.100 2.6e-02
ovarian cancer 1.300 1.8e-04
psoriasis 1.100 1.1e-03

AA Sequence

MVALENPECGPEAAEGTPGGRRLLPLPSCLPALASSQVKRLSASRRKQHFINQAVRNSDLVPKAKGRKSL      1 - 70
QRLENTQYLLTLLETDGGLPGLEDGDLAPPASPGIFAEACNNATYVEVWNDFMNRSGEEQERVLRYLEDE     71 - 140
GRSKARRRGPGRGEDRRREDPAYTPRECFQRISRRLRAVLKRSRIPMETLETWEERLLRFFSVSPQAVYT    141 - 210
AMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYLEQHS                211 - 268
//

Text Mined References (3)

PMID Year Title