Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.75
PubTator Score 28.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 6.3e-05
osteosarcoma 7950 4.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 6.3e-05
osteosarcoma 1.512 4.1e-04

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MQQESERCRVRARRPDMALYVPKARRGAVLLKTGDEEESCGSPNSVVKEKQKESSLSQKEVFKDKPEARR      1 - 70
LNINPDRKEHNCREEKKSSTKLRMDTCLQKTNRVCSKRGTTESKEVLSQGQQQGAPNAGVITNAPLQRHF     71 - 140
KPKKVECLEVETTDVTGHERILLSQACLEISEAQVPSKPFQNVEFCDFSRHEPDGEAFEDKDLEGRIETD    141 - 210
TKVLEILYEFPRVFSSVMKPENMIVPIKLSSDSEIVQQSMQTSDGILNPSSGGITTTSVPGSPDGVFDQT    211 - 280
CVDFEVESVGGIANSTGFILDQKDTDSIPATMGHISLSESTNDTVSPVMIRECEKNDSTADELHVKHEPP    281 - 350
DTAVLAHETHRDSGFKNVGDITNKACMMDTTGMSCSDHVTVDSPYVVAVRIADETSINTRSFSKFVGMSA    351 - 420
DATPLHVARSGNDTEDFSNPSACSDIYGESISSHFTESTGKLIESLSDCASSLPIKKIAGSNYNTFLDSE    421 - 490
LSMLNGTKVLSDSAVGIDLGSTGDTTEALHELRTAEEFKTEEQDDSGSIEFGVSFPDRESSSMETSIEPK    491 - 560
ATETSHTEGITAIEESWESMFNDDGDCLDPRLLQEGILMHIKPENHCSELSGNTKSRESIQEPRSDYYNH    561 - 630
EVPDIDLSDCEFPHVIEIYDFPQEFHTEDLLRVFCSYQKKGFDIKWVDDTHALGVFSSPITARDALGIKH    631 - 700
TMVKIRPLSQATRAAKAKARAYAEFLQPAKERPETSAALARRLVISALGVRSKQSKTEREAELKKLQEAR    701 - 770
ERKRLEAKQREDIWEGRDQSTV                                                    771 - 792
//

Text Mined References (13)

PMID Year Title