Property Summary

NCBI Gene PubMed Count 8
PubMed Score 74.94
PubTator Score 361.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.100 4.1e-06
osteosarcoma 1.383 1.5e-05
medulloblastoma 1.400 7.2e-04
atypical teratoid / rhabdoid tumor 1.200 2.1e-03
medulloblastoma, large-cell 1.400 7.7e-03
primitive neuroectodermal tumor 1.200 4.1e-02
interstitial cystitis 1.100 7.1e-03
pilocytic astrocytoma 1.300 3.1e-04
pituitary cancer 1.400 2.6e-04

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19805282 Studies showed in vitro Gln-tRNA(Gln) formation catalyzed by the recombinant mtGluRS and hGatCAB.
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLGRSLREVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRYKNGQSLGDLDG      1 - 70
IPIAVKDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKN     71 - 140
PWSYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKP    141 - 210
SYGLVSRHGLIPLVNSMDVPGILTRCVDDAAIVLGALAGPDPRDSTTVHEPINKPFMLPSLADVSKLCIG    211 - 280
IPKEYLVPELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHR    281 - 350
CDIDVSTEAMYAATRREGFNDVVRGRILSGNFFLLKENYENYFVKAQKVRRLIANDFVNAFNSGVDVLLT    351 - 420
PTTLSEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTV    421 - 490
AKWFEKQVQFPVIQLQELMDDCSAVLENEKLASVSLKQ                                    491 - 528
//

Text Mined References (12)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19805282 2009 Biogenesis of glutaminyl-mt tRNAGln in human mitochondria.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.