Property Summary

NCBI Gene PubMed Count 30
PubMed Score 132.55
PubTator Score 59.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.100 7.0e-03
ependymoma -2.500 3.9e-02
oligodendroglioma -2.100 4.0e-02
psoriasis -1.100 8.2e-03
sonic hedgehog group medulloblastoma -1.400 3.1e-02
medulloblastoma, large-cell -1.800 8.7e-03
lung cancer 2.500 6.7e-06
sarcoidosis 2.200 4.8e-02
lung adenocarcinoma 1.433 1.7e-02
gastric carcinoma 1.300 4.6e-02
mucosa-associated lymphoid tissue lympho... 1.596 1.1e-02
ulcerative colitis 1.100 9.7e-03
Breast cancer 1.500 1.4e-03

Gene RIF (20)

PMID Text
24164736 observations provide evidence for an involvement of QC in Alzheimer's disease pathogenesis and cognitive decline by QC-catalyzed pGlu-Abeta formation
23207485 this study demonistrated that QPCT mRNAand protein from mononuclear cells correlated with theseverity of dementia.
23183267 Upregulation of QPCT expression is associated with thyroid carcinomas.
21671571 This study presents a first comparison of two mammalian QCs (human and mouse) containing typical, conserved post-translational modifications.
21301857 The resilts of this studt provided histopathological evidence for QC being a prerequisite for pE-Abeta pathology in vivo and further underline the therapeutic potential of QC inhibition in Alzheimer Disease.
21288892 Upon binding to PBD150, a large loop movement in gQC allows the inhibitor to be tightly held in its active site primarily by hydrophobic interactions.
20383514 This study demonstrated that glutaminyl cyclase expression and pE-Abeta formation in subcortical brain regions( Edinger-Westphal nucleus, locus coeruleus and nucleus basalis Meynert) affected in Alzheimer's disease.
19804409 Human isoQC proteins displayed a broad substrate specificity and preference for hydrophobic substrates, similar to the related QC.
18486145 Golgi apparatus retention implies a "housekeeping" protein maturation machinery conducting glycosylation and pyroglutamyl formation. For these isoenzymes, apparently similar strategies evolved to retain the proteins in the Golgi complex.
18470930 The computations outline the important role of Trp329 in helping the substrate binding process and stabilizing the cyclization transition state.
18072935 combined steady-state enzyme kinetic and X-ray structural analyses of 11 single-mutation human QCs to investigate the roles of the H-bond network in catalysis
17687619 Observational study of gene-disease association. (HuGE Navigator)
17687619 Our results suggest that QPCT may be the QTL gene at chromosome 2p for spine BMD variation in the Chinese population
17334644 Observational study of gene-disease association. (HuGE Navigator)
16135565 structure of human QC in free form and bound to a substrate and three imidazole-derived inhibitors
15231017 Observational study of gene-disease association. (HuGE Navigator)
15231017 Genetic variations in QPCT are important factors affecting the bone mineral density of adult women that contribute to susceptibility for osteoporosis.
14680951 Glutaminyl cyclase was expressed as a fully active 37 kDa enzyme with kcat/Km values of 14.3, 9.3, and 2.4 mM(-1)s(-1) for the substrates Gln-Gln, Gln-NH(2), and Gln-t-butyl ester, respectively
14522962 human glutaminyl cyclase is a metal-dependent transferase
12196024 Functional expression of human glutaminyl cyclase in Pichia pastoris reveals the presence of a disulfide bond with an important role in the stabilization of active protein structure.

AA Sequence

MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDL      1 - 70
QPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACH     71 - 140
YDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQ    141 - 210
DSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHE    211 - 280
LGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI    281 - 350
LQVFVLEYLHL                                                               351 - 361
//

Text Mined References (33)

PMID Year Title
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24164736 2014 Glutaminyl cyclase in human cortex: correlation with (pGlu)-amyloid-? load and cognitive decline in Alzheimer's disease.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23207485 2013 Increased glutaminyl cyclase expression in peripheral blood of Alzheimer's disease patients.
23183267 2013 Role of glutaminyl cyclases in thyroid carcinomas.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
21671571 2011 Structures of glycosylated mammalian glutaminyl cyclases reveal conformational variability near the active center.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21301857 2011 Glutaminyl cyclase contributes to the formation of focal and diffuse pyroglutamate (pGlu)-A? deposits in hippocampus via distinct cellular mechanisms.
21288892 2011 Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding.
20383514 2010 Distinct glutaminyl cyclase expression in Edinger-Westphal nucleus, locus coeruleus and nucleus basalis Meynert contributes to pGlu-Abeta pathology in Alzheimer's disease.
19804409 2009 Mammalian glutaminyl cyclases and their isoenzymes have identical enzymatic characteristics.
18486145 2008 Isolation of an isoenzyme of human glutaminyl cyclase: retention in the Golgi complex suggests involvement in the protein maturation machinery.
18470930 2008 Computational evidence for the catalytic mechanism of glutaminyl cyclase. A DFT investigation.
18072935 2008 A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
17687619 2007 The association of common polymorphisms in the QPCT gene with bone mineral density in the Chinese population.
17334644 2007 Association of gene polymorphisms with blood pressure and the prevalence of hypertension in community-dwelling Japanese individuals.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16135565 2005 Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231017 2004 Association of multiple nucleotide variations in the pituitary glutaminyl cyclase gene (QPCT) with low radial BMD in adult women.
15063747 2004 Glutaminyl cyclases unfold glutamyl cyclase activity under mild acid conditions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14680951 2003 Human pituitary glutaminyl cyclase: expression in insect cells and dye affinity purification.
14522962 2003 Identification of human glutaminyl cyclase as a metalloenzyme. Potent inhibition by imidazole derivatives and heterocyclic chelators.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12196024 2002 Heterologous expression and characterization of human glutaminyl cyclase: evidence for a disulfide bond with importance for catalytic activity.
11551224 2001 Evidence for essential histidines in human pituitary glutaminyl cyclase.
7999256 1994 Molecular cloning, sequence analysis and expression of human pituitary glutaminyl cyclase.
3597387 1987 An enzyme(s) that converts glutaminyl-peptides into pyroglutamyl-peptides. Presence in pituitary, brain, adrenal medulla, and lymphocytes.