Property Summary

Ligand Count 173
NCBI Gene PubMed Count 32
PubMed Score 140.78
PubTator Score 59.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer 2.500 6.7e-06
astrocytic glioma -3.100 7.0e-03
Breast cancer 1.500 1.4e-03
ependymoma -2.500 3.9e-02
gastric carcinoma 1.300 4.6e-02
lung adenocarcinoma 1.433 1.7e-02
medulloblastoma -1.300 4.6e-02
medulloblastoma, large-cell -1.800 8.7e-03
mucosa-associated lymphoid tissue lympho... 1.596 1.1e-02
oligodendroglioma -2.100 4.0e-02
psoriasis -1.100 8.2e-03
sarcoidosis 2.200 4.8e-02
ulcerative colitis 1.100 9.7e-03

PDB (23)

Gene RIF (22)

AA Sequence

MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDL      1 - 70
QPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACH     71 - 140
YDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQ    141 - 210
DSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHE    211 - 280
LGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI    281 - 350
LQVFVLEYLHL                                                               351 - 361
//

Text Mined References (35)

PMID Year Title