Property Summary

NCBI Gene PubMed Count 59
PubMed Score 63.65
PubTator Score 55.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (38)

Disease log2 FC p
Rheumatoid Arthritis 1.600 3.2e-03
Multiple myeloma 1.952 8.0e-04
malignant mesothelioma 2.500 2.0e-07
astrocytic glioma 1.700 2.5e-02
ependymoma 2.000 8.8e-03
oligodendroglioma 1.700 1.8e-02
glioblastoma 1.800 1.7e-06
osteosarcoma 3.300 5.0e-10
group 4 medulloblastoma -3.300 3.4e-10
atypical teratoid/rhabdoid tumor 1.600 2.8e-07
medulloblastoma, large-cell -4.700 4.6e-06
primitive neuroectodermal tumor 1.600 9.0e-07
hereditary spastic paraplegia -1.110 1.2e-02
acute quadriplegic myopathy 1.168 2.4e-04
non-small cell lung cancer -2.084 9.0e-23
intraductal papillary-mucinous adenoma (... -2.500 6.6e-03
intraductal papillary-mucinous carcinoma... -2.800 9.2e-03
colon cancer -1.600 1.0e-02
lung cancer -2.900 2.7e-05
interstitial cystitis 1.100 7.1e-05
pediatric high grade glioma 1.800 1.8e-07
pilocytic astrocytoma 2.000 3.3e-10
primary Sjogren syndrome 1.300 1.9e-03
aldosterone-producing adenoma -1.086 2.4e-02
subependymal giant cell astrocytoma 1.580 1.7e-02
lung adenocarcinoma -2.108 2.3e-06
lung carcinoma -2.000 3.4e-31
Pick disease -1.200 3.7e-03
progressive supranuclear palsy -2.200 1.6e-02
Breast cancer -1.300 6.7e-06
gastric carcinoma 1.400 1.0e-02
ductal carcinoma in situ -1.900 3.0e-04
invasive ductal carcinoma -2.200 1.0e-03
ulcerative colitis 3.200 1.2e-08
ovarian cancer -3.100 2.2e-08
Down syndrome 1.400 7.9e-04
pancreatic cancer 1.100 3.6e-03
dermatomyositis 1.600 5.5e-04

Protein-protein Interaction (4)

Gene RIF (36)

PMID Text
27029405 QKI has a role in posttranscriptionally guiding macrophage identity and function.
26926106 QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
26829751 MYB-QKI rearrangements promote tumorigenesis through three mechanisms: MYB activation by truncation, enhancer translocation driving aberrant MYB-QKI expression and hemizygous loss of the tumor suppressor QKI
26337206 Data implicate QKI in the pathophysiology of inflammation and leukemoogenesis where miR-155 is involved.
26056009 miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation.
25768908 Using circScreen, study identified the RNA binding protein Quaking (QKI) as a major regulator of circRNA biogenesis in epithelial-mesenchymal transition (EMT) and show that introduction of consensus binding sequences for QKI into the flanking introns is sufficient to cause circRNAs to be produced from exons that normally only undergo canonical linear splicing.
25420938 miR-155 regulates the cell cycle and invasion ability of colon cancer cells via the modulation of QKI expression
24918581 QKI is a novel Cancer stem cells (CSC) inhibitor and impaired multiple oral CSC properties via partial repression of SOX2.
24722255 QKI as a key regulator of alternative splicing in lung cancer.
24398626 QKI-mediated repression of FOXO1 may be one of the factors contributing to the oncogenesis and progression of breast carcinoma.
24153116 the QKI-5 expression may be a novel, independent factor in the prognosis of prostate cancer patients.
23963726 Propose that QKI is a central regulator of VSMC phenotypic plasticity and that intervention in QKI activity can ameliorate pathogenic, fibroproliferative responses to vascular injury.
23525800 This work provides the first evidence that QK is a global regulator of splicing during muscle development in vertebrates and shows how overlapping splicing regulatory networks contribute to gene expression programs during differentiation.
23440637 Data showed that like QKI5/6/7 proteins, QKI7b protein was also significantly downregulated in most human colorectal cancer tissues.
23321059 QKI is a hub regulator of glia function in humans.
22944692 Positional proteomics analysis identifies the cleavage of human KH domain containing, RNA binding (QKI) at amino acid residues 163-164 by the HIV-1 protease
22751500 establish that p53 directly regulates Quaking (QKI) gene expression, and QKI protein associates with and leads to the stabilization of miR-20a
22569043 Multivariate analysis showed QKI expression was an independent prognostic factor for patient survival.
22490519 Findings suggest that miR-574-5p is a potent ribo-regulator for Qkis and that aberrant miR-574-5p upregulation can be oncogenic.
22398723 The RNA-binding protein QKI5 is a direct target of C/EBPalpha and delays macrophage differentiation.
21844227 QKI, regulates the alternative splicing of macroH2A1 pre-mRNA, resulting in increased levels of macroH2A1.1.
21768773 E2F1 directly transcribes QKI, which, in turn, negatively regulates the cell cycle by targeting multiple cell cycle regulators, forming an E2F1-QKI-pRb/E2F1 negative feedback loop.
21467216 HSV-1 infection promotes quaking RNA binding protein production and induces nuclear-cytoplasmic shuttling of quaking I-5 isoform in human hepatoma cells
20927331 QKI-7 regulates expression of interferon-related genes in human astrocyte glioma cells.
20631256 The QKI RNA-binding proteins regulate oligodendrocyte differentiation by modulating the expression of AIP-1.
19686745 QKI functions as a principal regulator in the differentiation of colon epithelium and a suppressor of carcinogenesis through coordinately targeting multiple genes associated with cell growth and differentiation
19545858 The observation of consistent reductions in multiple isoforms of QKI mRNA in depressed suicide victims supports the growing body of evidence for a role of myelination-related deficits in the etiology of psychiatric disorders
18938205 variants within the promoter region of QKI gene are unlikely to play a major role in susceptibility to schizophrenia in the Chinese population
18938205 Observational study of gene-disease association. (HuGE Navigator)
17918747 we examined expression of QKI and several putative mRNA targets of QKI in human PFC and hippocampus at different ages
17787018 biological functions attributed to this KH-type RNA binding protein and the recent achievements linking it to human disorders
17079655 QKI-6 is the major protein isoform responsible for central nervous system (CNS) myelination, which promotes myelin basic protein expression in oligodendrocytes.
17012699 Since QKI plays a fundamental role in oligodendrocyte differentiation and in myelination, its underexpression may be pivotal to, and upstream of, other myelin-associated gene expression abnormalities in schizophrenia.
16641098 QKI levels may regulate oligodendrocyte differentiation and maturation in human brain
16342280 QKI as a possible target for functional studies related to the role of myelination in schizophrenia.
10535969 There are many isoforms of this RNA binding protein. QKI-6 has been shown to be a translational repressor.

AA Sequence

MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA      1 - 70
ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG     71 - 140
KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK    141 - 210
SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE    211 - 280
AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN             281 - 341
//

Text Mined References (65)

PMID Year Title
27029405 2016 Quaking promotes monocyte differentiation into pro-atherogenic macrophages by controlling pre-mRNA splicing and gene expression.
26926106 2016 The STAR protein QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
26829751 2016 MYB-QKI rearrangements in angiocentric glioma drive tumorigenicity through a tripartite mechanism.
26337206 2015 Quaking and miR-155 interactions in inflammation and leukemogenesis.
26056009 2015 miR-29a promotes scavenger receptor A expression by targeting QKI (quaking) during monocyte-macrophage differentiation.
25768908 2015 The RNA binding protein quaking regulates formation of circRNAs.
25420938 2015 MicroRNA-155 promotes the proliferation and invasion abilities of colon cancer cells by targeting quaking.
25416956 2014 A proteome-scale map of the human interactome network.
24918581 2014 QKI impairs self-renewal and tumorigenicity of oral cancer cells via repression of SOX2.
24722255 2014 The RNA-binding protein QKI suppresses cancer-associated aberrant splicing.
24398626 2014 Post-transcriptional repression of FOXO1 by QKI results in low levels of FOXO1 expression in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24153116 2014 The tumor suppressing effects of QKI-5 in prostate cancer: a novel diagnostic and prognostic protein.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23963726 2013 Quaking, an RNA-binding protein, is a critical regulator of vascular smooth muscle cell phenotype.
23630077 2013 Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
23525800 2013 Quaking and PTB control overlapping splicing regulatory networks during muscle cell differentiation.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23440637 2013 Preparation and characterizations of polyclonal antibodies against STAR protein QKI7b.
23321059 2013 RNA-binding protein QKI regulates Glial fibrillary acidic protein expression in human astrocytes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22751500 2012 STAR RNA-binding protein Quaking suppresses cancer via stabilization of specific miRNA.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22569043 2012 Downregulation of tumor suppressor QKI in gastric cancer and its implication in cancer prognosis.
22490519 2013 miR-574-5p negatively regulates Qki6/7 to impact ?-catenin/Wnt signalling and the development of colorectal cancer.
22398723 2012 The RNA-binding protein QKI5 is a direct target of C/EBP? and delays macrophage differentiation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21844227 2011 QKI-mediated alternative splicing of the histone variant MacroH2A1 regulates cancer cell proliferation.
21768773 2011 E2F1 and RNA binding protein QKI comprise a negative feedback in the cell cycle regulation.
21684615 2011 Altering the expression balance of hnRNP C1 and C2 changes the expression of myelination-related genes.
21467216 2011 HSV-1 Cgal+ infection promotes quaking RNA binding protein production and induces nuclear-cytoplasmic shuttling of quaking I-5 isoform in human hepatoma cells.
21269460 2011 Initial characterization of the human central proteome.
21165711 2011 Production and characterization of polyclonal and monoclonal Abs against the RNA-binding protein QKI.
20956316 2010 Quaking I controls a unique cytoplasmic pathway that regulates alternative splicing of myelin-associated glycoprotein.
20927331 2010 QKI-7 regulates expression of interferon-related genes in human astrocyte glioma cells.
20631256 2010 The QKI-6 RNA binding protein regulates actin-interacting protein-1 mRNA stability during oligodendrocyte differentiation.
20082458 2010 Haploinsufficiency of the gene Quaking (QKI) is associated with the 6q terminal deletion syndrome.
19686745 2010 RNA-binding protein quaking, a critical regulator of colon epithelial differentiation and a suppressor of colon cancer.
19545858 2009 Characterization of QKI gene expression, genetics, and epigenetics in suicide victims with major depressive disorder.
18938205 2009 No association found between the promoter variations of QKI and schizophrenia in the Chinese population.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17918747 2008 Developmental expression profile of quaking, a candidate gene for schizophrenia, and its target genes in human prefrontal cortex and hippocampus shows regional specificity.
17787018 2008 New implications for the QUAKING RNA binding protein in human disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17079655 2006 Rescuing qkV dysmyelination by a single isoform of the selective RNA-binding protein QKI.
17012699 2006 The human homolog of the QKI gene affected in the severe dysmyelination "quaking" mouse phenotype: downregulated in multiple brain regions in schizophrenia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16641098 2006 Human QKI, a potential regulator of mRNA expression of human oligodendrocyte-related genes involved in schizophrenia.
16342280 2006 Human QKI, a new candidate gene for schizophrenia involved in myelination.
16205629 2006 Small regions of overlapping deletions on 6q26 in human astrocytic tumours identified using chromosome 6 tile path array-CGH.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12529443 2003 Sam68 RNA binding protein is an in vivo substrate for protein arginine N-methyltransferase 1.
12511597 2003 Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11917126 2002 Function of quaking in myelination: regulation of alternative splicing.
11856480 2002 Expression of Hqk encoding a KH RNA binding protein is altered in human glioma.
10535969 1999 The STAR protein QKI-6 is a translational repressor.
9671495 1998 Structure-function analysis of Qk1: a lethal point mutation in mouse quaking prevents homodimerization.
8589716 1996 The quaking gene product necessary in embryogenesis and myelination combines features of RNA binding and signal transduction proteins.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.