Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

AA Sequence

MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQA      1 - 70
GRKGNIIPLTVWNDWAIIKAALEPFQTEEDSVSVSDAPGSCIIDCNENTRKKSQKETESLHCEYVAEPVM     71 - 140
AQSTQNVDYNQLQEVIYPETLKLEGKVPELVGPSESKPRGTSRLPAGQVPVTLQPQTQVKENKTQPPVAY    141 - 210
QYWPPAELQYRPPLESQYGYPGMPPAPQGRAPYPQPPTRRLNPTAPPSRRGSELHEIIDKSRKEGDTEAW    211 - 280
QFPVTLEPMPPGEGAQEGEPPTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDW    281 - 350
EILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVR    351 - 420
AICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIAIEKARKVIVELMAYENPNPECQS    421 - 490
AIKPLKGKVPAGSDVISEYVKACDGMGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCP    491 - 560
VLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFDKNGQPLSGNEQRGQPQAPQQTGAFPIQPFV    561 - 630
PHGFQGQQPPLSQVFQGISQLPQYNNCPPPQAAVQQ                                      631 - 666
//

Text Mined References (11)

PMID Year Title