Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

AA Sequence

MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGKELKQA      1 - 70
GRKGNIIPLTVWNDWAIIKAALEPFQTEEDSVSVSDAPGSCIIDCNENTRKKSQKETESLHCEYVAEPVM     71 - 140
AQSTQNVDYNQLQEVIYPETLKLEGKVPELVGPSESKPRGTSRLPAGQVPVTLQPQTQVKENKTQPPVAY    141 - 210
QYWPPAELQYRPPLESQYGYPGMPPAPQGRAPYPQPPTRRLNPTAPPSRRGSELHEIIDKSRKEGDTEAW    211 - 280
QFPVTLEPMPPGEGAQEGEPPTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDW    281 - 350
EILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVR    351 - 420
AICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIAIEKARKVIVELMAYENPNPECQS    421 - 490
AIKPLKGKVPAGSDVISEYVKACDGMGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCP    491 - 560
VLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFDKNGQPLSGNEQRGQPQAPQQTGAFPIQPFV    561 - 630
PHGFQGQQPPLSQVFQGISQLPQYNNCPPPQAAVQQ                                      631 - 666
//

Text Mined References (11)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14557543 2003 Genomewide screening for fusogenic human endogenous retrovirus envelopes identifies syncytin 2, a gene conserved on primate evolution.
12970426 2003 Survey of human genes of retroviral origin: identification and transcriptome of the genes with coding capacity for complete envelope proteins.
12629516 2003 Quantitation of HERV-K env gene expression and splicing in human breast cancer.
10516026 1999 Genome-wide screening, cloning, chromosomal assignment, and expression of full-length human endogenous retrovirus type K.
9533039 1997 Chromosomal assignment of human endogenous retrovirus K (HERV-K) env open reading frames.
9460924 1998 Evolutionary relationships within a subgroup of HERV-K-related human endogenous retroviruses.
9060628 1997 Expression of human endogenous retrovirus type K envelope glycoprotein in insect and mammalian cells.
More...