Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
R01 Count 1
Funding $647,581.91
PubMed Score 5.25
PubTator Score 24.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.300 0.000

Gene RIF (4)

PMID Text
26154564 Data indicate differences in the plasma concentrations of collectin liver 1 and collectin kidney 1, M-ficolin and H-ficol in systemic lupus erythematosus (SLE) patients compared to a group of healthy controls.
25710878 Carriers of COLEC10 Arg125Trp had increased CL-L1 serum levels.
24174618 Most plasma CL-K1 was found in complex with CL-L1 in a ratio suggesting a heteromeric subunit of 1 CL-L1 & 2 CL-K1 polypeptides.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNGFASLLRRNQFILLVLFLLQIQSLGLDIDSRPTAEVCATHTISPGPKGDDGEKGDPGEEGKHGKVGRM      1 - 70
GPKGIKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRYRKFVGQLDISIARLKT     71 - 140
SMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEAANTLIADYVAKSGFFRVFIG    141 - 210
VNDLEREGQYMFTDNTPLQNYSNWNEGEPSDPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK       211 - 277
//

Text Mined References (20)

PMID Year Title
26154564 2015 Collectin liver 1 and collectin kidney 1 and other complement-associated pattern recognition molecules in systemic lupus erythematosus.
25710878 2015 Genetic variation of COLEC10 and COLEC11 and association with serum levels of collectin liver 1 (CL-L1) and collectin kidney 1 (CL-K1).
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24174618 2013 Heteromeric complexes of native collectin kidney 1 and collectin liver 1 are found in the circulation with MASPs and activate the complement system.
23437003 2013 Genetic determinants of trabecular and cortical volumetric bone mineral densities and bone microstructure.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
More...