Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9Y6Z5 B4DW86 Q8NB23
Symbols HGC6.4
AFDN-AS1
C6orf124
MLLT4-AS1
dJ431P23.3

Gene

 Compartment GO Term (0)

AA Sequence

MGAAGSDGRCCVRSGRAGTGGAGSKWVVMDLWTGGAGSRRAVLGPDGRWVRWAVLGSVRMGGARSKWAAP      1 - 70
DPMGGAGFGPDWRVRVWTGGAGSKWGCSAGSGRAVLGPNGRWVPWAVLGSVRTGGAGSKWAALGPMGGTG     71 - 140
SGRAVLGLDGRCSIQMGAAGSGRAVLGSVRTGGAGSKWAVLGSAGDRWAWRHRYGAQGRWSALSEGPCAP    141 - 210
RARCSSCPRIAPGLLRVSSRVIPFRWVTSKPTFSSCFLPRRTRC                              211 - 254
//

Text Mined References (4)

PMID Year Title