Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9Y6Z5 B4DW86 Q8NB23
Symbols HGC6.4
C6orf124
MLLT4-AS1
dJ431P23.3

Gene

 Compartment GO Term (0)

AA Sequence

MGAAGSDGRCCVRSGRAGTGGAGSKWVVMDLWTGGAGSRRAVLGPDGRWVRWAVLGSVRMGGARSKWAAP      1 - 70
DPMGGAGFGPDWRVRVWTGGAGSKWGCSAGSGRAVLGPNGRWVPWAVLGSVRTGGAGSKWAALGPMGGTG     71 - 140
SGRAVLGLDGRCSIQMGAAGSGRAVLGSVRTGGAGSKWAVLGSAGDRWAWRHRYGAQGRWSALSEGPCAP    141 - 210
RARCSSCPRIAPGLLRVSSRVIPFRWVTSKPTFSSCFLPRRTRC                              211 - 254
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
10382971 1999 Complete DNA sequence and characterization of a 330-kb VNTR-rich region on chromosome 6q27 that is commonly deleted in ovarian cancer.