Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9Y6Z2 E1P5C8 Q5TIG8
Symbols HGC6.2
C6orf123
LINC01557
dJ431P23.4

Gene

 Compartment GO Term (1)

AA Sequence

MGTAVGPHHSPAPHDSALPARLLTSDFPYGRSCQIEQVKYSVPDTGLFQHWEGSIPT                   1 - 57
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10382971 1999 Complete DNA sequence and characterization of a 330-kb VNTR-rich region on chromosome 6q27 that is commonly deleted in ovarian cancer.