Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q9Y6Z2 E1P5C8 Q5TIG8
Symbols HGC6.2
C6orf123
LINC01557
dJ431P23.4

 Compartment GO Term (1)

AA Sequence

MGTAVGPHHSPAPHDSALPARLLTSDFPYGRSCQIEQVKYSVPDTGLFQHWEGSIPT                   1 - 57
//

Text Mined References (4)

PMID Year Title