Property Summary

NCBI Gene PubMed Count 124
PubMed Score 541.15
PubTator Score 211.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Rheumatoid arthritis 1191

Expression

  Differential Expression (31)

Disease log2 FC p
adult high grade glioma 1.800 3.9e-03
Astrocytoma, Pilocytic 2.200 6.3e-08
chronic rhinosinusitis 1.228 4.2e-02
cutaneous lupus erythematosus 2.000 1.3e-03
cystic fibrosis 3.625 1.2e-07
dermatomyositis 1.900 1.4e-02
diabetes mellitus -1.100 3.3e-02
Duchenne muscular dystrophy 1.464 5.2e-09
gastric carcinoma 2.000 3.1e-02
glioblastoma 1.800 2.9e-04
group 4 medulloblastoma -1.200 1.6e-02
inflammatory breast cancer 1.200 7.6e-03
interstitial cystitis 2.100 2.1e-04
intraductal papillary-mucinous adenoma (... -2.100 4.8e-03
intraductal papillary-mucinous carcinoma... -2.500 3.1e-04
intraductal papillary-mucinous neoplasm ... -2.400 1.2e-03
invasive ductal carcinoma 1.632 3.7e-02
juvenile dermatomyositis 1.656 6.8e-08
lung cancer -2.000 3.7e-03
lung carcinoma -2.300 3.0e-19
malignant mesothelioma 1.300 3.3e-06
medulloblastoma, large-cell -1.800 1.5e-03
nephrosclerosis 1.323 1.4e-03
non diabetic and post-ischemic heart fai... -1.600 2.4e-02
ovarian cancer -2.700 1.7e-06
periodontitis 1.100 1.0e-21
pituitary cancer -2.500 4.8e-07
psoriasis -1.500 6.1e-03
subependymal giant cell astrocytoma 3.896 6.7e-03
tuberculosis 1.400 7.3e-07
ulcerative colitis 4.000 3.1e-08

Gene RIF (110)

AA Sequence

MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRD      1 - 70
LKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISG     71 - 140
SPEEMLFCLEFVILHQPNSN                                                      141 - 160
//

Text Mined References (125)

PMID Year Title