Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.77
PubTator Score 46.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.0e-05
hepatocellular carcinoma 1.200 9.9e-06
intraductal papillary-mucinous adenoma (... 1.700 8.9e-04
intraductal papillary-mucinous carcinoma... 1.100 6.3e-04
medulloblastoma, large-cell 1.200 5.5e-04
osteosarcoma -1.196 1.3e-04
ovarian cancer -1.300 4.3e-03
primary Sjogren syndrome 1.100 3.0e-03
psoriasis -1.100 4.8e-03
Rheumatoid arthritis 1.200 4.4e-02

Gene RIF (6)

AA Sequence

MAERKPNGGSGGASTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQT      1 - 70
SIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTALPFTTGSQDVSNAFSPSISKA     71 - 140
QPGAPPSSLMGINSYLPSQPSSLPPSYFGNQPQGIPQPGYNPYRHTPGSSRANPYIAPPQLQQCQTPGPP    141 - 210
AHPPPSGPPVQMYQMPPGSLPPVPSSVQSPAQQQVPARPGAPSVQVPSPFLLQNQYEPVQPHWFYCKEVE    211 - 280
YKQLWMPFSVFDSLNLEEIYNSVQPDPESVVLGTDGGRYDVYLYDRIRKAAYWEEEPAEVRRCTWFYKGD    281 - 350
TDSRFIPYTEEFSEKLEAEYKKAVTTNQWHRRLEFPSGETIVMHNPKVIVQFQPSSVPDEWGTTQDGQTR    351 - 420
PRVVKRGIDDNLDEIPDGEMPQVDHLVFVVHGIGPVCDLRFRSIIECVDDFRVVSLKLLRTHFKKSLDDG    421 - 490
KVSRVEFLPVHWHSSLGGDATGVDRNIKKITLPSIGRFRHFTNETLLDILFYNSPTYCQTIVEKVGMEIN    491 - 560
HLHALFMSRNPDFKGGVSVAGHSLGSLILFDILSNQKDLNLSKCPGPLAVANGVVKQLHFQEKQMPEEPK    561 - 630
LTLDESYDLVVENKEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFV    631 - 700
EHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAG    701 - 770
QVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLD    771 - 840
LKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIK    841 - 910
EEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTA    911 - 980
LLLLKEIYRTMNISPEQPQH                                                      981 - 1000
//

Text Mined References (24)

PMID Year Title