Property Summary

NCBI Gene PubMed Count 17
Grant Count 8
R01 Count 8
Funding $444,674.5
PubMed Score 6.51
PubTator Score 46.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
24522181 A basic cluster and a hydrophobic interface in the DDHD and SAM domains, respectively, are required for p125A-mediated functional endoplasmic reticulum exit site assembly.
20679433 The results suggest that p125A is part of the Sec13/Sec31A subcomplex and facilitates ER export in mammalian cells.
20308572 Xenopus sec23ip is required for normal neural crest cell development, suggesting a role for the human ortholog in Waardenburg syndrome neural crest defects.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15623529 p125 is a mammalian-specific component of ER exit sites and participates in the organization of this compartment

AA Sequence

MAERKPNGGSGGASTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQT      1 - 70
SIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTALPFTTGSQDVSNAFSPSISKA     71 - 140
QPGAPPSSLMGINSYLPSQPSSLPPSYFGNQPQGIPQPGYNPYRHTPGSSRANPYIAPPQLQQCQTPGPP    141 - 210
AHPPPSGPPVQMYQMPPGSLPPVPSSVQSPAQQQVPARPGAPSVQVPSPFLLQNQYEPVQPHWFYCKEVE    211 - 280
YKQLWMPFSVFDSLNLEEIYNSVQPDPESVVLGTDGGRYDVYLYDRIRKAAYWEEEPAEVRRCTWFYKGD    281 - 350
TDSRFIPYTEEFSEKLEAEYKKAVTTNQWHRRLEFPSGETIVMHNPKVIVQFQPSSVPDEWGTTQDGQTR    351 - 420
PRVVKRGIDDNLDEIPDGEMPQVDHLVFVVHGIGPVCDLRFRSIIECVDDFRVVSLKLLRTHFKKSLDDG    421 - 490
KVSRVEFLPVHWHSSLGGDATGVDRNIKKITLPSIGRFRHFTNETLLDILFYNSPTYCQTIVEKVGMEIN    491 - 560
HLHALFMSRNPDFKGGVSVAGHSLGSLILFDILSNQKDLNLSKCPGPLAVANGVVKQLHFQEKQMPEEPK    561 - 630
LTLDESYDLVVENKEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFV    631 - 700
EHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAG    701 - 770
QVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLD    771 - 840
LKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIK    841 - 910
EEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTA    911 - 980
LLLLKEIYRTMNISPEQPQH                                                      981 - 1000
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24522181 2014 A cascade of ER exit site assembly that is regulated by p125A and lipid signals.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22922100 2012 Roles of SAM and DDHD domains in mammalian intracellular phospholipase A1 KIAA0725p.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20679433 2010 p125A exists as part of the mammalian Sec13/Sec31 COPII subcomplex to facilitate ER-Golgi transport.
20308572 2010 Systematic discovery of nonobvious human disease models through orthologous phenotypes.
More...