Property Summary

NCBI Gene PubMed Count 40
PubMed Score 33.07
PubTator Score 36.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
CEREBELLAR ATAXIA, NONPROGRESSIVE, WITH MENTAL RETARDATION 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Alopecia areata 41 0.0 0.8
Type 2 diabetes mellitus 272 0.0 1.9
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -2.500 2.1e-07
astrocytic glioma -1.400 2.6e-02
Astrocytoma, Pilocytic -1.700 4.2e-08
atypical teratoid / rhabdoid tumor -2.800 1.2e-04
Breast cancer 3.000 2.5e-02
cystic fibrosis -2.218 1.3e-06
ependymoma -2.300 1.9e-02
glioblastoma -2.400 1.1e-09
group 3 medulloblastoma 1.500 1.5e-04
intraductal papillary-mucinous adenoma (... 2.500 4.9e-04
lung cancer -1.200 4.4e-02
malignant mesothelioma 5.900 3.9e-10
medulloblastoma, large-cell -3.100 4.8e-05
non-small cell lung cancer -1.370 1.6e-10
oligodendroglioma -2.200 1.3e-02
osteosarcoma 1.322 1.1e-04
ovarian cancer -1.100 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.037 3.8e-02
Pick disease 1.100 2.9e-03
primitive neuroectodermal tumor -1.400 8.9e-03
psoriasis -1.900 5.9e-04
tuberculosis and treatment for 3 months 1.100 1.5e-03

Gene RIF (28)

AA Sequence

MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKCSSLPKE      1 - 70
RHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKL     71 - 140
KVQGVECLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWT    141 - 210
KEELIGQLKPMFHGIKWTCSNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGSLGAGGSVHHKCNS    211 - 280
AKHRIISPKVEPRTGGYGSHSEVQHNDVSEGKHEHSHSKGSSREKRNGKVAKPVLLHQSSTEVSSTNQVE    281 - 350
VPDTTQSSPVSISSGLNSDPDMVDSPVVTGVSGMAVASVMGSLSQSATVFMSEVTNEAVYTMSPTAGPNH    351 - 420
HLLSPDASQGLVLAVSSDGHKFAFPTTGSSESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLN    421 - 490
NPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTEDTSFEQQMAKEAYSSSAAAVAASSL    491 - 560
TLTAGSSLLPSGGGLSPSTTLEQMDFSAIDSNKDYTSSFSQTGHSPHIHQTPSPSFFLQDASKPLPVEQN    561 - 630
THSSLSDSGGTFVMPTVKTEASSQTSSCSGHVETRIESTSSLHLMQFQANFQAMTAEGEVTMETSQAAEG    631 - 700
SEVLLKSGELQACSSEHYLQPETNGVIRSAGGVPILPGNVVQGLYPVAQPSLGNASNMELSLDHFDISFS    701 - 770
NQFSDLINDFISVEGGSSTIYGHQLVSGDSTALSQSEDGARAPFTQAEMCLPCCSPQQGSLQLSSSEGGA    771 - 840
STMAYMHVAEVVSAASAQGTLGMLQQSGRVFMVTDYSPEWSYPEGGVKVLITGPWQEASNNYSCLFDQIS    841 - 910
VPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKARALPTLPSSQHDWLSLDDNQFRMSIL    911 - 980
ERLEQMERRMAEMTGSQQHKQASGGGSSGGGSGSGNGGSQAQCASGTGALGSCFESRVVVVCEKMMSRAC    981 - 1050
WAKSKHLIHSKTFRGMTLLHLAAAQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACAL   1051 - 1120
GHLEAAVVLYKWDRRAISIPDSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNPRIHCPASEEPST   1121 - 1190
ESWMAQWHSEAISSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKHKLNPEYFQTRQEKL   1191 - 1260
LPTALSLEEPNIRKQSPSSKQSVPETLSPSEGVRDFSRELSPPTPETAAFQASGSQPVGKWNSKDLYIGV   1261 - 1330
STVQVTGNPKGTSVGKEAAPSQVRPREPMSVLMMANREVVNTELGSYRDSAENEECGQPMDDIQVNMMTL   1331 - 1400
AEHIIEATPDRIKQENFVPMESSGLERTDPATISSTMSWLASYLADADCLPSAAQIRSAYNEPLTPSSNT   1401 - 1470
SLSPVGSPVSEIAFEKPNLPSAADWSEFLSASTSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKG   1471 - 1540
RPLREQQEVAAAVIQRCYRKYKQYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAVLIQKYYRSYKKC   1541 - 1610
GKRRQARRTAVIVQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLYKRSERIEKGQGT          1611 - 1673
//

Text Mined References (41)

PMID Year Title