Property Summary

NCBI Gene PubMed Count 38
Grant Count 7
R01 Count 7
Funding $577,789.4
PubMed Score 29.73
PubTator Score 36.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 5.900 0.000
astrocytic glioma -2.300 0.004
ependymoma -3.300 0.000
oligodendroglioma -2.200 0.013
psoriasis -1.900 0.001
glioblastoma -3.500 0.000
osteosarcoma 1.322 0.000
medulloblastoma -1.500 0.000
cystic fibrosis -2.218 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -1.400 0.009
pancreatic ductal adenocarcinoma liver m... -1.037 0.038
tuberculosis and treatment for 3 months 1.100 0.001
non-small cell lung cancer -1.370 0.000
intraductal papillary-mucinous adenoma (... 2.500 0.000
lung cancer -1.200 0.044
Breast cancer 3.000 0.025
adult high grade glioma -3.200 0.000
pilocytic astrocytoma -2.100 0.000
Pick disease 1.100 0.003
ovarian cancer 2.700 0.000

Gene RIF (26)

PMID Text
26414223 Nuclear expression of CAMTA1 can be used in the differential diagnosis of epithelioid hemangioendotheliomas.
25961935 Our findings elucidate the mechanistic basis of the oncogenic properties of TAZ-CAMTA1 fusion
25879300 Nuclear CAMTA1 expression is sensitive and highly specific for epithelioid haemangioendothelioma and can be applied to diagnostic immunohistochemistry in epithelioid tumours.
25817592 we demonstrate additional structural complexity in WWTR1-CAMTA1 fusion transcripts in epithelioid haemangioendothelioma
25353289 Report CAMTA1-WWTR1 gene fusion in thoracic epithelioid hemangioendothelioma but not epithelioid angiosarcoma.
25110239 Epithelioid hemangioendothelioma, it's potential mimickers, and other benign or malignant vascular tumors showed strong and diffuse CAMTA1 expression, nullifying it's potential use as an adjunct in the differential diagnosis.
24738973 Intragenic CAMTA1 deletions are associated with a spectrum of neurobehavioral phenotypes
22715383 Cell-cell communications between the stem cells and adjacent cardiomyocytes induce Ca(2+) signals that activate a myocardial gene program in the stem cells via a novel and early Ca(2+)-dependent intermediate, up-regulation of CAMTA1.
22693284 The authors present evidence that loss-of-function of CAMTA1, a brain-specific calcium responsive transcription factor, is responsible for NPCA with or without ID.
22429593 Using reverse transcription-polymerase chain reaction (RT-PCR) and subsequent sequencing, we confirmed an identical WWTR1-CAMTA1 fusion transcript product from different nodules in each patient.
More...

AA Sequence

MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKCSSLPKE      1 - 70
RHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKL     71 - 140
KVQGVECLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWT    141 - 210
KEELIGQLKPMFHGIKWTCSNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGSLGAGGSVHHKCNS    211 - 280
AKHRIISPKVEPRTGGYGSHSEVQHNDVSEGKHEHSHSKGSSREKRNGKVAKPVLLHQSSTEVSSTNQVE    281 - 350
VPDTTQSSPVSISSGLNSDPDMVDSPVVTGVSGMAVASVMGSLSQSATVFMSEVTNEAVYTMSPTAGPNH    351 - 420
HLLSPDASQGLVLAVSSDGHKFAFPTTGSSESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLN    421 - 490
NPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTEDTSFEQQMAKEAYSSSAAAVAASSL    491 - 560
TLTAGSSLLPSGGGLSPSTTLEQMDFSAIDSNKDYTSSFSQTGHSPHIHQTPSPSFFLQDASKPLPVEQN    561 - 630
THSSLSDSGGTFVMPTVKTEASSQTSSCSGHVETRIESTSSLHLMQFQANFQAMTAEGEVTMETSQAAEG    631 - 700
SEVLLKSGELQACSSEHYLQPETNGVIRSAGGVPILPGNVVQGLYPVAQPSLGNASNMELSLDHFDISFS    701 - 770
NQFSDLINDFISVEGGSSTIYGHQLVSGDSTALSQSEDGARAPFTQAEMCLPCCSPQQGSLQLSSSEGGA    771 - 840
STMAYMHVAEVVSAASAQGTLGMLQQSGRVFMVTDYSPEWSYPEGGVKVLITGPWQEASNNYSCLFDQIS    841 - 910
VPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKARALPTLPSSQHDWLSLDDNQFRMSIL    911 - 980
ERLEQMERRMAEMTGSQQHKQASGGGSSGGGSGSGNGGSQAQCASGTGALGSCFESRVVVVCEKMMSRAC    981 - 1050
WAKSKHLIHSKTFRGMTLLHLAAAQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACAL   1051 - 1120
GHLEAAVVLYKWDRRAISIPDSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNPRIHCPASEEPST   1121 - 1190
ESWMAQWHSEAISSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKHKLNPEYFQTRQEKL   1191 - 1260
LPTALSLEEPNIRKQSPSSKQSVPETLSPSEGVRDFSRELSPPTPETAAFQASGSQPVGKWNSKDLYIGV   1261 - 1330
STVQVTGNPKGTSVGKEAAPSQVRPREPMSVLMMANREVVNTELGSYRDSAENEECGQPMDDIQVNMMTL   1331 - 1400
AEHIIEATPDRIKQENFVPMESSGLERTDPATISSTMSWLASYLADADCLPSAAQIRSAYNEPLTPSSNT   1401 - 1470
SLSPVGSPVSEIAFEKPNLPSAADWSEFLSASTSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKG   1471 - 1540
RPLREQQEVAAAVIQRCYRKYKQYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAVLIQKYYRSYKKC   1541 - 1610
GKRRQARRTAVIVQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLYKRSERIEKGQGT          1611 - 1673
//

Text Mined References (39)

PMID Year Title
26414223 2016 Nuclear Expression of CAMTA1 Distinguishes Epithelioid Hemangioendothelioma From Histologic Mimics.
25961935 2016 Mechanism of action of a WWTR1(TAZ)-CAMTA1 fusion oncoprotein.
25879300 2015 CAMTA1 is a useful immunohistochemical marker for diagnosing epithelioid haemangioendothelioma.
25817592 2015 Molecular characterization of epithelioid haemangioendotheliomas identifies novel WWTR1-CAMTA1 fusion variants.
25353289 2015 Thoracic epithelioid malignant vascular tumors: a clinicopathologic study of 52 cases with emphasis on pathologic grading and molecular studies of WWTR1-CAMTA1 fusions.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
25110239 2014 CAMTA1 immunostaining is not useful in differentiating epithelioid hemangioendothelioma from its potential mimickers.
24770850 2014 Genome-wide association study of sexual maturation in males and females highlights a role for body mass and menarche loci in male puberty.
24738973 2015 Intragenic CAMTA1 deletions are associated with a spectrum of neurobehavioral phenotypes.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
More...