Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.29
PubTator Score 1282.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.281 1.6e-06
astrocytoma 1.100 3.7e-02
atypical teratoid / rhabdoid tumor 1.300 7.9e-04
breast carcinoma 1.300 6.0e-03
cystic fibrosis -1.300 1.2e-03
dermatomyositis 1.300 7.6e-04
diabetes mellitus -1.100 1.8e-02
glioblastoma 1.100 3.4e-02
group 3 medulloblastoma 1.800 5.3e-05
intraductal papillary-mucinous adenoma (... 1.900 4.4e-04
intraductal papillary-mucinous carcinoma... 1.800 4.1e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.6e-02
invasive ductal carcinoma 1.100 2.5e-02
lung cancer 1.200 7.2e-04
medulloblastoma, large-cell 1.600 1.3e-04
ovarian cancer -2.000 3.2e-05
Pick disease -1.100 6.2e-04
pituitary cancer -1.300 2.8e-05
progressive supranuclear palsy -1.200 2.1e-02
psoriasis -1.300 2.2e-03
X-linked cerebral adrenoleukodystrophy 1.400 2.7e-02

Gene RIF (7)

AA Sequence

MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGI      1 - 70
SHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNF     71 - 140
ASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENG    141 - 210
DSLEELMEEVQTLYYSADHKLLDGNLLDGQAEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNA    211 - 280
TVQSPKHEWKIVASEKTSNNTYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKP    281 - 350
MSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV    351 - 420
GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLKNCDVFDPVTK    421 - 490
LWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLNGK    491 - 560
LFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGIATVGNTIYAVGGFDGNEFLNTVEVYNLES    561 - 630
NEWSPYTKIFQF                                                              631 - 642
//

Text Mined References (24)

PMID Year Title