Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 5
Funding $202,083.35
PubMed Score 10.10
PubTator Score 1282.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y6Y0 A8K8R6 Q1G4T6 Q1G4T7 Q5TF75 Q6NW38 Q7LCG2 Q9NZX0 Q9Y480 NS1-BP
Symbols ND1
NS-1
NS1BP
FLARA3
KLHL39
NS1-BP
HSPC068

Gene

Gene RIF (7)

PMID Text
25619834 Our study identifies KLHL39 as a negative regulator of Cul3-KLHL20 ubiquitin ligase and reveals a role of KLHL39-mediated PML and DAPK stabilization in colon cancer metastasis.
24210102 This study provided evidence that miRNA-548an is involved in the regulation of NS1ABP.
23825951 NS1-BP-hnRNPK complex is a key mediator of influenza A virus gene expression.
22190034 HIV-1 Gag is identified to have a physical interaction with influenza virus NS1A binding protein (IVNS1ABP; NS1BP) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17996313 These findings further support the distinct roles of alpha-enolase and its MBP-1 variant in maintaining cell homeostasis. Moreover, these data suggest a novel function for NS1-BP in the control of cell proliferation.

AA Sequence

MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGI      1 - 70
SHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNF     71 - 140
ASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENG    141 - 210
DSLEELMEEVQTLYYSADHKLLDGNLLDGQAEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNA    211 - 280
TVQSPKHEWKIVASEKTSNNTYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKP    281 - 350
MSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV    351 - 420
GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLKNCDVFDPVTK    421 - 490
LWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLNGK    491 - 560
LFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGIATVGNTIYAVGGFDGNEFLNTVEVYNLES    561 - 630
NEWSPYTKIFQF                                                              631 - 642
//

Text Mined References (24)

PMID Year Title
25619834 2015 KLHL39 suppresses colon cancer metastasis by blocking KLHL20-mediated PML and DAPK ubiquitination.
24210102 2013 Expression of non-structural-1A binding protein in lung epithelial cells is modulated by miRNA-548an on exposure to influenza A virus.
23825951 2013 Cellular RNA binding proteins NS1-BP and hnRNP K regulate influenza A virus RNA splicing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...