Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
R01 Count 2
Funding $162,369
PubMed Score 8.90
PubTator Score 8.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 1.100 0.024
psoriasis 1.900 0.000
osteosarcoma -2.229 0.000
astrocytoma 1.600 0.001
pancreatic ductal adenocarcinoma liver m... 1.118 0.035
non-small cell lung cancer 1.161 0.000
lung cancer 1.100 0.000
group 3 medulloblastoma 1.400 0.002
ovarian cancer 2.000 0.000

Gene RIF (8)

PMID Text
26659848 have identified a new locus in which MORC2 mutations are the likely pathogenic cause of CMT2 and pyramidal signs in these families.
26497905 identified two different mutations in the MORC2 gene in patients from three unrelated families presenting with an axonal motor and sensory neuropathy.
26476214 MORC2 down-regulates the ArgBP2 via histone methylation in gastric cancer cells.
26098774 MORC2 down-regulated p21 by recruiting HDAC1 to the p21 promoter, in a p53-independent manner. MORC2 expression correlated negatively with p21 expression in gastric tumors in patients.
25888627 PAK1-mediated MORC2 phosphorylation promotes gastric tumorigenesis
24286864 these results demonstrate a cytosolic function of MORC2 in lipogenesis, adipogenic differentiation, and lipid homeostasis by regulating the activity of ACLY.
23260667 the PAK1-MORC2 axis is critical for orchestrating the interplay between chromatin dynamics and the maintenance of genomic integrity through sequentially integrating multiple essential enzymatic processes.
20225202 Analysis of MORC2 functional domains, subcellular localization and mRNA and protein expression demonstrates its role of nuclear localization in association with a proline-rich domain regulating gene transcriptional repression in cancer cells.

AA Sequence

MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNARDADATRIDIYAERREDLRGGFMLCFLDDG      1 - 70
AGMDPSDAASVIQFGKSAKRTPESTQIGQYGNGLKSGSMRIGKDFILFTKKEDTMTCLFLSRTFHEEEGI     71 - 140
DEVIVPLPTWNARTREPVTDNVEKFAIETELIYKYSPFRTEEEVMTQFMKIPGDSGTLVIIFNLKLMDNG    141 - 210
EPELDIISNPRDIQMAETSPEGTKPERRSFRAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYT    211 - 280
SSRFKTRAEQEVKKAEHVARIAEEKAREAESKARTLEVRLGGDLTRDSRVMLRQVQNRAITLRREADVKK    281 - 350
RIKEAKQRALKEPKELNFVFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLV    351 - 420
LEPTHNKQDFADAKEYRHLLRAMGEHLAQYWKDIAIAQRGIIKFWDEFGYLSANWNQPPSSELRYKRRRA    421 - 490
MEIPTTIQCDLCLKWRTLPFQLSSVEKDYPDTWVCSMNPDPEQDRCEASEQKQKVPLGTFRKDMKTQEEK    491 - 560
QKQLTEKIRQQQEKLEALQKTTPIRSQADLKKLPLEVTTRPSTEEPVRRPQRPRSPPLPAVIRNAPSRPP    561 - 630
SLPTPRPASQPRKAPVISSTPKLPALAAREEASTSRLLQPPEAPRKPANTLVKTASRPAPLVQQLSPSLL    631 - 700
PNSKSPREVPSPKVIKTPVVKKTESPIKLSPATPSRKRSVAVSDEEEVEEEAERRKERCKRGRFVVKEEK    701 - 770
KDSNELSDSAGEEDSADLKRAQKDKGLHVEVRVNREWYTGRVTAVEVGKHVVRWKVKFDYVPTDTTPRDR    771 - 840
WVEKGSEDVRLMKPPSPEHQSLDTQQEGGEEEVGPVAQQAIAVAEPSTSECLRIEPDTTALSTNHETIDL    841 - 910
LVQILRNCLRYFLPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVGLQNLCNSYQSRADSRAKASEESL    911 - 980
RTSERKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD                      981 - 1032
//

Text Mined References (32)

PMID Year Title
26659848 2016 MORC2 mutations cause axonal Charcot-Marie-Tooth disease with pyramidal signs.
26497905 2016 Mutations in the MORC2 gene cause axonal Charcot-Marie-Tooth disease.
26476214 2015 Microchidia protein 2, MORC2, downregulates the cytoskeleton adapter protein, ArgBP2, via histone methylation in gastric cancer cells.
26098774 2015 By recruiting HDAC1, MORC2 suppresses p21 Waf1/Cip1 in gastric cancer.
25888627 2015 PAK1-mediated MORC2 phosphorylation promotes gastric tumorigenesis.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24286864 2014 Cytosolic functions of MORC2 in lipogenesis and adipogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23260667 2012 MORC2 signaling integrates phosphorylation-dependent, ATPase-coupled chromatin remodeling during the DNA damage response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...