Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.27
PubTator Score 4.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.500 5.6e-03
astrocytoma -1.600 1.5e-02
Atopic dermatitis -1.100 2.4e-03
atypical teratoid / rhabdoid tumor -1.900 1.1e-04
Down syndrome 1.100 6.4e-03
glioblastoma multiforme -1.100 2.2e-05
group 3 medulloblastoma -2.300 1.0e-03
hereditary spastic paraplegia -1.166 5.5e-03
lung cancer -1.700 1.4e-04
medulloblastoma, large-cell -2.100 1.2e-05
nasopharyngeal carcinoma -1.300 1.0e-02
non-small cell lung cancer -1.847 5.4e-14
osteosarcoma -1.442 2.3e-02
ovarian cancer 1.700 1.2e-03
Pick disease -1.400 8.6e-03
primitive neuroectodermal tumor -1.300 2.3e-03
progressive supranuclear palsy -1.600 1.2e-02
psoriasis -1.400 3.0e-07
spina bifida -1.196 2.8e-02

Gene RIF (2)

AA Sequence

MKLLVILLFSGLITGFRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKT      1 - 70
FPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTD     71 - 140
VPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKI    141 - 210
DDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEV    211 - 280
YNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLA    281 - 350
AHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCINLPEAIAIVIGSLLVLTM    351 - 420
LTCLIIIMQNRLSVPRPFSRLQLQEDDDDPLIG                                         421 - 453
//

Text Mined References (11)

PMID Year Title