Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.14
PubTator Score 4.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 5.37442619830257E-14
glioblastoma multiforme 347 2.39588998711509E-7
psoriasis 6685 3.03544985446359E-7
medulloblastoma, large-cell 6234 1.22068917436071E-5
atypical teratoid / rhabdoid tumor 4369 1.06275693160329E-4
lung cancer 4473 1.4408753538265E-4
group 3 medulloblastoma 2254 4.96011530639888E-4
ovarian cancer 8492 0.00123956474350007
primitive neuroectodermal tumor 3031 0.0023196560131825
Atopic dermatitis 944 0.00242456961065073
hereditary spastic paraplegia 313 0.00550068341260488
adult high grade glioma 2148 0.00556769263573915
Down syndrome 548 0.00638010165127672
Pick disease 1893 0.0086285168491006
nasopharyngeal carcinoma 1056 0.0104398673961717
progressive supranuclear palsy 674 0.0124025314012
astrocytoma 1493 0.0146471928608132
osteosarcoma 7933 0.0230538211032428
spina bifida 1064 0.035817889435841

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis -1.400 0.000
glioblastoma multiforme -1.200 0.000
osteosarcoma -1.442 0.023
group 3 medulloblastoma -2.600 0.000
astrocytoma -1.600 0.015
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.300 0.002
hereditary spastic paraplegia -1.166 0.006
Atopic dermatitis -1.100 0.002
non-small cell lung cancer -1.847 0.000
lung cancer -1.700 0.000
adult high grade glioma -1.500 0.006
nasopharyngeal carcinoma -1.300 0.010
spina bifida -1.256 0.036
Pick disease -1.400 0.009
progressive supranuclear palsy -1.600 0.012
ovarian cancer 1.700 0.001
Down syndrome 1.100 0.006

Synonym

Accession Q9Y6X5 A8K5G1 Q7L2N1
Symbols NPP4

Gene

PDB

4LQY   4LR2  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 CSPA Cell Line (1)

Gene RIF (2)

PMID Text
24338010 The combined studies expand our understanding of NPP1 and NPP4 substrate specificity and range and provide a rational mechanism by which polymorphisms in NPP1 confer stroke resistance.
22995898 NPP4 promotes hemostasis in vivo by augmenting ADP-mediated platelet aggregation at the site of vascular injury.

AA Sequence

MKLLVILLFSGLITGFRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKT      1 - 70
FPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTD     71 - 140
VPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKI    141 - 210
DDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEV    211 - 280
YNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLA    281 - 350
AHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCINLPEAIAIVIGSLLVLTM    351 - 420
LTCLIIIMQNRLSVPRPFSRLQLQEDDDDPLIG                                         421 - 453
//

Text Mined References (11)

PMID Year Title
24338010 2014 Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
22995898 2012 NPP4 is a procoagulant enzyme on the surface of vascular endothelium.
19946888 2010 Defining the membrane proteome of NK cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11027689 2001 Structural and catalytic similarities between nucleotide pyrophosphatases/phosphodiesterases and alkaline phosphatases.
More...