Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.58
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.55175137847948E-52
lung carcinoma 2844 2.16620387326963E-46
non-small cell lung cancer 2798 1.58466952805025E-11
osteosarcoma 7933 8.92287502722086E-11
sonic hedgehog group medulloblastoma 1482 8.48319308588947E-7
lung cancer 4473 1.64755836385553E-6
interstitial cystitis 2299 2.16100776303954E-6
medulloblastoma, large-cell 6234 3.20729515740689E-5
pediatric high grade glioma 2712 4.1129108741319E-5
cystic fibrosis 1670 1.40114645005964E-4
malignant mesothelioma 3163 3.67130385842495E-4
glioblastoma 5572 4.80020935397449E-4
atypical teratoid / rhabdoid tumor 4369 7.68693428456463E-4
Pick disease 1893 0.0061606078597704
colon cancer 1475 0.0101919366544665
Parkinson's disease 364 0.0116912762560558
adrenocortical carcinoma 1427 0.0398036850468889

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
glioblastoma -2.100 0.000
osteosarcoma -2.441 0.000
sonic hedgehog group medulloblastoma -2.900 0.000
cystic fibrosis 1.832 0.000
atypical teratoid / rhabdoid tumor -1.200 0.001
medulloblastoma, large-cell -2.200 0.000
adrenocortical carcinoma 1.348 0.040
non-small cell lung cancer 1.165 0.000
lung cancer 3.700 0.000
colon cancer 1.600 0.010
Parkinson's disease -1.300 0.012
interstitial cystitis -2.300 0.000
pediatric high grade glioma -1.800 0.000
lung carcinoma 3.500 0.000
Pick disease 1.400 0.006
psoriasis 1.500 0.000

Synonym

Accession Q9Y6X4 A8K1T9 Q6MZT0 Q9H989 SLAP75
Symbols SLAP75

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MAFPVDMLENCSHEELENSAEDYMSDLRCGDPENPECFSLLNITIPISLSNVGFVPLYGGDQTQKILALF      1 - 70
APEDSLTAVALYLADQWWAIDDIVKTSVPSREGLKQVSTLGERVVLYVLNRIIYRKQEMERNEIPFLCHS     71 - 140
STDYAKILWKKGEAIGFYSVKPTGSICASFLTQSYQLPVLDTMFLRKKYRGKDFGLHMLEDFVDSFTEDA    141 - 210
LGLRYPLSSLMYTACKQYFEKYPGDHELLWEVEGVGHWYQRIPVTRALQREALKILALSQNEPKRPMSGE    211 - 280
YGPASVPEYEARTEDNQSSEMQLTIDSLKDAFASTSEGHDKTSVSTHTRSGNLKRPKIGKRFQDSEFSSS    281 - 350
QGEDEKTSQTSLTASINKLESTARPSESSEEFLEEEPEQRGIEFEDESSDRDARPALETQPQQEKQDGEK    351 - 420
ESELEPMNGEIMDDSLKTSLITEEEDSTSEVLDEELKLQPFNSSEDSTNLVPLVVESSKPPEVDAPDKTP    421 - 490
RIPDSEMLMDEGTSDEKGHMEEKLSLLPRKKAHLGSSDNVATMSNEERSDGGFPNSVIAEFSEEPVSENL    491 - 560
SPNTTSSLEDQGEEGVSEPQETSTALPQSSLIEVELEDVPFSQNAGQKNQSEEQSEASSEQLDQFTQSAE    561 - 630
KAVDSSSEEIEVEVPVVDRRNLRRKAKGHKGPAKKKAKLT                                  631 - 670
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22412018 2012 A promiscuous biotin ligase fusion protein identifies proximal and interacting proteins in mammalian cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...