Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.58
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
glioblastoma -2.100 0.000
osteosarcoma -2.441 0.000
sonic hedgehog group medulloblastoma -2.900 0.000
cystic fibrosis 1.832 0.000
atypical teratoid / rhabdoid tumor -1.200 0.001
medulloblastoma, large-cell -2.200 0.000
adrenocortical carcinoma 1.348 0.040
non-small cell lung cancer 1.165 0.000
lung cancer 3.700 0.000
colon cancer 1.600 0.010
Parkinson's disease -1.300 0.012
interstitial cystitis -2.300 0.000
pediatric high grade glioma -1.800 0.000
lung carcinoma 3.500 0.000
Pick disease 1.400 0.006
psoriasis 1.500 0.000

AA Sequence

MAFPVDMLENCSHEELENSAEDYMSDLRCGDPENPECFSLLNITIPISLSNVGFVPLYGGDQTQKILALF      1 - 70
APEDSLTAVALYLADQWWAIDDIVKTSVPSREGLKQVSTLGERVVLYVLNRIIYRKQEMERNEIPFLCHS     71 - 140
STDYAKILWKKGEAIGFYSVKPTGSICASFLTQSYQLPVLDTMFLRKKYRGKDFGLHMLEDFVDSFTEDA    141 - 210
LGLRYPLSSLMYTACKQYFEKYPGDHELLWEVEGVGHWYQRIPVTRALQREALKILALSQNEPKRPMSGE    211 - 280
YGPASVPEYEARTEDNQSSEMQLTIDSLKDAFASTSEGHDKTSVSTHTRSGNLKRPKIGKRFQDSEFSSS    281 - 350
QGEDEKTSQTSLTASINKLESTARPSESSEEFLEEEPEQRGIEFEDESSDRDARPALETQPQQEKQDGEK    351 - 420
ESELEPMNGEIMDDSLKTSLITEEEDSTSEVLDEELKLQPFNSSEDSTNLVPLVVESSKPPEVDAPDKTP    421 - 490
RIPDSEMLMDEGTSDEKGHMEEKLSLLPRKKAHLGSSDNVATMSNEERSDGGFPNSVIAEFSEEPVSENL    491 - 560
SPNTTSSLEDQGEEGVSEPQETSTALPQSSLIEVELEDVPFSQNAGQKNQSEEQSEASSEQLDQFTQSAE    561 - 630
KAVDSSSEEIEVEVPVVDRRNLRRKAKGHKGPAKKKAKLT                                  631 - 670
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22412018 2012 A promiscuous biotin ligase fusion protein identifies proximal and interacting proteins in mammalian cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...