Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.58
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.348 4.0e-02
adult high grade glioma -1.300 9.1e-05
atypical teratoid / rhabdoid tumor -1.200 7.7e-04
colon cancer 1.600 1.0e-02
cystic fibrosis 1.832 1.4e-04
glioblastoma -1.300 2.4e-03
group 4 medulloblastoma -1.300 1.4e-02
interstitial cystitis -1.800 2.0e-03
lung cancer 2.300 6.4e-05
lung carcinoma 3.500 2.2e-46
malignant mesothelioma -1.200 3.7e-04
medulloblastoma, large-cell -1.800 2.9e-03
non-small cell lung cancer 1.165 1.6e-11
osteosarcoma -1.814 2.7e-02
Parkinson's disease -1.300 1.2e-02
Pick disease 1.400 6.2e-03
psoriasis 1.500 3.6e-52

Synonym

Accession Q9Y6X4 A8K1T9 Q6MZT0 Q9H989 SLAP75
Symbols SLAP75

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAFPVDMLENCSHEELENSAEDYMSDLRCGDPENPECFSLLNITIPISLSNVGFVPLYGGDQTQKILALF      1 - 70
APEDSLTAVALYLADQWWAIDDIVKTSVPSREGLKQVSTLGERVVLYVLNRIIYRKQEMERNEIPFLCHS     71 - 140
STDYAKILWKKGEAIGFYSVKPTGSICASFLTQSYQLPVLDTMFLRKKYRGKDFGLHMLEDFVDSFTEDA    141 - 210
LGLRYPLSSLMYTACKQYFEKYPGDHELLWEVEGVGHWYQRIPVTRALQREALKILALSQNEPKRPMSGE    211 - 280
YGPASVPEYEARTEDNQSSEMQLTIDSLKDAFASTSEGHDKTSVSTHTRSGNLKRPKIGKRFQDSEFSSS    281 - 350
QGEDEKTSQTSLTASINKLESTARPSESSEEFLEEEPEQRGIEFEDESSDRDARPALETQPQQEKQDGEK    351 - 420
ESELEPMNGEIMDDSLKTSLITEEEDSTSEVLDEELKLQPFNSSEDSTNLVPLVVESSKPPEVDAPDKTP    421 - 490
RIPDSEMLMDEGTSDEKGHMEEKLSLLPRKKAHLGSSDNVATMSNEERSDGGFPNSVIAEFSEEPVSENL    491 - 560
SPNTTSSLEDQGEEGVSEPQETSTALPQSSLIEVELEDVPFSQNAGQKNQSEEQSEASSEQLDQFTQSAE    561 - 630
KAVDSSSEEIEVEVPVVDRRNLRRKAKGHKGPAKKKAKLT                                  631 - 670
//

Text Mined References (11)

PMID Year Title