Property Summary

NCBI Gene PubMed Count 64
Grant Count 48
R01 Count 41
Funding $3,773,524.35
PubMed Score 50.83
PubTator Score 56.21

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
26768588 PIAS3 may serve as a biomarker for predicting hormone therapy stratification, although it is limited to those breast cancer patients receiving hormone therapy.
26697750 Taken together, these results suggest that PIAS3 functions as a positive regulator of HIF-1alpha-mediated transcription by increasing its protein stability.
26667168 PIAS3 suppression may be protective against joint destruction in rheumatoid arthritis by regulating synoviocyte migration, invasion, and activation.
26565033 PIAS3 primes ATR for checkpoint activation.
26223632 Adenovirus E4-ORF3 targets PIAS3 and together with E1B-55K remodels SUMO2/SUMO3 Interactions in the nucleus and at virus genome replication domains.
26116514 HIV-1 gp120 upregulates PIAS3 expression in primary human monocyte-derived dendritic cells
25573684 PIAS3 expression in squamous cell lung cancer is low and predicts overall survival
25137041 Statistically significant positive correlation has been found between STAT5B and COX-2, and significant negative correlation between STAT5B and PIAS3.
25124686 Low PIAS3 expression in malignant mesothelioma is associated with increased STAT3 activation and poor patient survival.
25008924 HIV-1 gp120 upregulates PIAS3 expression in primary human monocyte-derived dendritic cells
More...

AA Sequence

MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTL      1 - 70
GPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGE     71 - 140
LIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPN    141 - 210
LFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQL    211 - 280
TAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFD    281 - 350
AALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP    351 - 420
PGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQ    421 - 490
PSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFF    491 - 560
QYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD      561 - 628
//

Text Mined References (69)

PMID Year Title
26768588 2016 Prognostic value of protein inhibitor of activated STAT3 in breast cancer patients receiving hormone therapy.
26697750 2016 PIAS3 enhances the transcriptional activity of HIF-1? by increasing its protein stability.
26667168 2016 Protein Inhibitor of Activated STAT3 Regulates Migration, Invasion, and Activation of Fibroblast-like Synoviocytes in Rheumatoid Arthritis.
26565033 2016 The SUMO (Small Ubiquitin-like Modifier) Ligase PIAS3 Primes ATR for Checkpoint Activation.
26223632 2015 Adenovirus E4-ORF3 Targets PIAS3 and Together with E1B-55K Remodels SUMO Interactions in the Nucleus and at Virus Genome Replication Domains.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25573684 2015 PIAS3 expression in squamous cell lung cancer is low and predicts overall survival.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25137041 2014 Expression of STAT5, COX-2 and PIAS3 in correlation with NSCLC histhopathological features.
More...