Property Summary

NCBI Gene PubMed Count 17
Grant Count 10
R01 Count 5
Funding $388,253.33
PubMed Score 29.54
PubTator Score 17.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.130 0.004
psoriasis 1.600 0.000
osteosarcoma 1.472 0.000
posterior fossa group B ependymoma 1.800 0.000
glioblastoma 1.200 0.001
medulloblastoma, large-cell -1.200 0.001
Duchenne muscular dystrophy 1.156 0.000
juvenile dermatomyositis 1.066 0.000
acute quadriplegic myopathy 1.065 0.000
primary pancreatic ductal adenocarcinoma -1.750 0.001
lung cancer -2.500 0.045
breast carcinoma 1.300 0.015
Breast cancer 3.500 0.024
group 4 medulloblastoma -1.100 0.006
ovarian cancer -1.200 0.000
pancreatic cancer -1.900 0.001

Gene RIF (9)

PMID Text
25719802 expression of SFRP1 mRNA and protein correlates with the Gleason score, survival rate and response for endocrine therapy of prostate cancer.
24489003 HIV-1 Tat modulates SERP1 expression in neuron cells
24489003 HIV-1 Tat modulates SERP1 expression in neuron cells
22526458 SERP1 is a novel cochaperone and regulator of ENaC expression.
22419128 SFRP1 DNA methylation, accumulates with age in normal-appearing kidney tissues and is associated with increased renal cancer risk.
21956116 HIV-1 Tat modulates SERP1 expression in neuron cells
21816823 HIV-1 Tat modulates SERP1 expression in neuron cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM          1 - 66
//

Text Mined References (17)

PMID Year Title
25719802 2015 Diagnostic value of SFRP1 as a favorable predictive and prognostic biomarker in patients with prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22526458 2012 Regulation of ENaC biogenesis by the stress response protein SERP1.
22419128 2012 SFRP1 CpG island methylation locus is associated with renal cell cancer susceptibility and disease recurrence.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...