Property Summary

NCBI Gene PubMed Count 17
PubMed Score 31.03
PubTator Score 17.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.065 2.9e-06
Breast cancer 3.500 2.4e-02
breast carcinoma 1.300 1.5e-02
Duchenne muscular dystrophy 1.156 8.3e-08
ependymoma 1.200 5.7e-08
glioblastoma 1.200 1.2e-03
group 4 medulloblastoma -1.100 6.4e-03
juvenile dermatomyositis 1.066 6.1e-12
lung cancer -2.500 4.5e-02
medulloblastoma, large-cell -1.200 8.6e-04
Multiple myeloma 1.130 3.7e-03
osteosarcoma 1.472 9.7e-05
ovarian cancer -1.100 3.9e-03
pancreatic cancer -1.600 3.9e-04
primary pancreatic ductal adenocarcinoma -1.750 7.2e-04
psoriasis 1.600 2.8e-04

Gene RIF (8)

AA Sequence

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM          1 - 66
//

Text Mined References (17)

PMID Year Title