Property Summary

NCBI Gene PubMed Count 17
PubMed Score 29.54
PubTator Score 17.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 6.09679553279741E-12
posterior fossa group B ependymoma 1530 8.56381633912967E-11
Duchenne muscular dystrophy 602 8.29900783288201E-8
acute quadriplegic myopathy 1157 2.94991329504281E-6
osteosarcoma 7933 9.70748161540253E-5
ovarian cancer 8492 2.64704788701073E-4
psoriasis 6685 2.77396444638579E-4
pancreatic cancer 2300 6.4788431730261E-4
primary pancreatic ductal adenocarcinoma 1271 7.17647503123967E-4
medulloblastoma, large-cell 6234 8.59137004551982E-4
glioblastoma 5572 0.00115944052524856
Multiple myeloma 1328 0.00370659080182423
group 4 medulloblastoma 1875 0.00639147112614653
breast carcinoma 1614 0.0146524524313764
Breast cancer 3099 0.0238523710285762
lung cancer 4473 0.0447165191881217

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.130 0.004
psoriasis 1.600 0.000
osteosarcoma 1.472 0.000
posterior fossa group B ependymoma 1.800 0.000
glioblastoma 1.200 0.001
medulloblastoma, large-cell -1.200 0.001
Duchenne muscular dystrophy 1.156 0.000
juvenile dermatomyositis 1.066 0.000
acute quadriplegic myopathy 1.065 0.000
primary pancreatic ductal adenocarcinoma -1.750 0.001
lung cancer -2.500 0.045
breast carcinoma 1.300 0.015
Breast cancer 3.500 0.024
group 4 medulloblastoma -1.100 0.006
ovarian cancer -1.200 0.000
pancreatic cancer -1.900 0.001

Synonym

Accession Q9Y6X1 D3DNI6
Symbols RAMP4

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (8)

PMID Text
25719802 expression of SFRP1 mRNA and protein correlates with the Gleason score, survival rate and response for endocrine therapy of prostate cancer.
24489003 HIV-1 Tat modulates SERP1 expression in neuron cells
22526458 SERP1 is a novel cochaperone and regulator of ENaC expression.
22419128 SFRP1 DNA methylation, accumulates with age in normal-appearing kidney tissues and is associated with increased renal cancer risk.
21956116 HIV-1 Tat modulates SERP1 expression in neuron cells
21816823 HIV-1 Tat modulates SERP1 expression in neuron cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM          1 - 66
//

Text Mined References (17)

PMID Year Title
25719802 2015 Diagnostic value of SFRP1 as a favorable predictive and prognostic biomarker in patients with prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22526458 2012 Regulation of ENaC biogenesis by the stress response protein SERP1.
22419128 2012 SFRP1 CpG island methylation locus is associated with renal cell cancer susceptibility and disease recurrence.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...