Property Summary

NCBI Gene PubMed Count 135
PubMed Score 39.21
PubTator Score 219.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 2.4e-121
lung carcinoma 2843 4.8e-10
osteosarcoma 7950 1.3e-05
cutaneous lupus erythematosus 1057 1.6e-03
lung cancer 4740 2.7e-03
interstitial cystitis 2312 3.6e-03
primary Sjogren syndrome 735 5.0e-03
Disease Target Count Z-score Confidence
Alopecia areata 41 0.0 3.0
Celiac disease 116 0.0 3.0
Disease Target Count Z-score Confidence
Agammaglobulinemia 34 3.199 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.600 1.6e-03
interstitial cystitis 1.800 3.6e-03
lung cancer -1.400 2.7e-03
lung carcinoma -1.700 4.8e-10
osteosarcoma -1.798 1.3e-05
primary Sjogren syndrome 1.200 5.0e-03
psoriasis 2.900 2.4e-121

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (127)

AA Sequence

MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKG      1 - 70
SGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK     71 - 140
FWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL               141 - 199
//

Text Mined References (135)

PMID Year Title