Property Summary

NCBI Gene PubMed Count 130
Grant Count 330
R01 Count 194
Funding $27,772,216.97
PubMed Score 31.68
PubTator Score 219.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.600 0.002
osteosarcoma -1.798 0.000
lung cancer -1.400 0.003
interstitial cystitis 1.800 0.004
primary Sjogren syndrome 1.200 0.005
lung carcinoma -1.700 0.000
psoriasis 2.900 0.000

Synonym

Accession Q9Y6W8 Q8N6W8
Symbols AILIM
CD278
CVID1

Gene

Gene RIF (122)

PMID Text
26560438 The ICOS and ICOSL SNPs examined do not have an apparent effect on the disease susceptibility and prognosis of autoimmune thyroid diseases.
26415669 findings show Tregs from inflamed lung of sarcoidosis patients characterized by ICOS(high) phenotype; high-level ICOS expression was restricted to Tregs from inflamed lung and was absent in blood Tregs of sarcoidosis patients and in lung and blood Tregs of healthy volunteers; potential implication of ICOS/ICOS-L immune-regulatory axis in in disease activity and resolution
26399252 novel deletion mutation in Pakistani siblings presents in childhood with a combined Immunodeficiency associated with an enteritis, hepatitis and impaired antiviral immunity
26231034 findings indicated that circulating memory Tfh cells, especially CCR7+ICOS+ memory Tfh cells, may be associated with the relapse of MS and may serve as a new therapeutic target
26120879 Follicular helper T cells differentiation is a multistage process involving BCL6 and other transcription factors, cytokines, and costimulation through ICOS and several other molecules. (Review)
26074057 This study found that ICOS rs1559931 SNP was associated with decreased hepatitis B virus-related hepatocellular carcinoma risk in the studied Chinese Han population, except for patients with natural clearance of hepatitis B virus.
25769613 ICOS-ICOS-L interaction promoted cytokine production and survival in type 2 innate lymphoid cells through STAT5 signaling in asthma.
25646266 ICOS maintains the T follicular helper cell phenotype by down-regulating Kruppel-like factor 2.
25569260 Expression of mutant caspase-9 correlated with a downregulation of BAFFR (B-cell-activating factor belonging to the TNF family (BAFF) receptor) in B cells and ICOS (inducible T-cell costimulator) in T cells.
25404409 Increased numbers of circulating ICOS(+) and IL-21(+) Tfh and CD38(+) plasma cells may be exhibited by patients with recent diagnoses of primary biliary cirrhosis.
More...

AA Sequence

MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKG      1 - 70
SGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK     71 - 140
FWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL               141 - 199
//

Text Mined References (130)

PMID Year Title
26560438 2016 Association of polymorphisms in the ICOS and ICOSL genes with the pathogenesis of autoimmune thyroid diseases.
26415669 2016 Pulmonary sarcoidosis is associated with high-level inducible co-stimulator (ICOS) expression on lung regulatory T cells--possible implications for the ICOS/ICOS-ligand axis in disease course and resolution.
26399252 2015 Astute Clinician Report: A Novel 10 bp Frameshift Deletion in Exon 2 of ICOS Causes a Combined Immunodeficiency Associated with an Enteritis and Hepatitis.
26231034 2015 Circulating CCR7+ICOS+ Memory T Follicular Helper Cells in Patients with Multiple Sclerosis.
26120879 2015 Development and function of follicular helper T cells.
26074057 2015 Association of Inducible T Cell Costimulator Polymorphisms with Susceptibility and Outcome of Hepatitis B Virus Infection in a Chinese Han Population.
25769613 2015 ICOS:ICOS-ligand interaction is required for type 2 innate lymphoid cell function, homeostasis, and induction of airway hyperreactivity.
25646266 2015 ICOS maintains the T follicular helper cell phenotype by down-regulating Krüppel-like factor 2.
25569260 2015 A mutation in caspase-9 decreases the expression of BAFFR and ICOS in patients with immunodeficiency and lymphoproliferation.
25404409 2015 Increased numbers of circulating ICOS? follicular helper T and CD38? plasma cells in patients with newly diagnosed primary biliary cirrhosis.
More...