Property Summary

NCBI Gene PubMed Count 39
PubMed Score 38.16
PubTator Score 24.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.809 3.8e-03
active ulcerative colitis 1.316 1.2e-02
acute myeloid leukemia 1.500 5.8e-03
Amyotrophic lateral sclerosis 1.074 4.2e-07
diabetes mellitus -1.400 7.2e-03
ductal carcinoma in situ 1.300 7.3e-03
gastric carcinoma 1.200 4.5e-02
invasive ductal carcinoma 1.100 2.3e-03
malignant mesothelioma -1.700 4.9e-06
mucosa-associated lymphoid tissue lympho... -1.218 3.0e-02
oligodendroglioma -1.300 4.3e-02
ovarian cancer 1.200 6.8e-05
pituitary cancer 1.100 5.2e-03
psoriasis -1.500 1.9e-03
sonic hedgehog group medulloblastoma 1.100 1.2e-02
tuberculosis -2.100 1.8e-05

Protein-protein Interaction (4)

Gene RIF (21)

AA Sequence

MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSANPGSNSHPPVIATTVVSLKAANLTYMPSSSGSARS      1 - 70
LNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGT     71 - 140
PKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKI    141 - 210
TVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNH    211 - 280
ENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGY    281 - 350
VINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI    351 - 420
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV            421 - 482
//

Text Mined References (40)

PMID Year Title