Property Summary

NCBI Gene PubMed Count 36
Grant Count 36
R01 Count 20
Funding $5,104,157.9
PubMed Score 35.89
PubTator Score 24.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
25973098 In females, three SNPs were associated with decreased colorectal cancer risk: rs11118838, rs12724393, and rs908858. However, in males, only one SNP, rs908858, was associated with decreased colorectal cancer risk.
25772234 Increased Dusp10 expression is associated with better survival rate in colorectal cancer patients.
24975273 Data suggest that vitamin D receptor target genes (DUSP10; THBD, thrombomodulin; NRIP1, nuclear receptor interacting protein 1; TRAK1, trafficking protein kinesin binding 1) can be used as markers for individual's response to vitamin D3 supplements.
23993976 Depletion of miR-181 family members by miRNA inhibitors enhanced the expression of MKP-5 and suppressed the phosphorylation of p38 MAPK after exposure to PAHs, which promotes cancer cell migration.
23936387 Single nucleotide polymorphism in DUSP10 gene is associated with celiac disease.
23872954 Certain mutations in DUSP10 correlate with the incidence of colorectal cancer(CRC). Thus, the function of the DUSP10 gene product may contribute toward CRC in the Han Chinese population.
23233447 Data indicate that the activities of phosphoprotein phosphatases MKP5 and MKP7 were determined in the system.
22711061 MKP-5 interacts with ERK, retains it in the cytoplasm, suppresses its activation and downregulates ERK-dependent transcription.
22375048 A distinct interaction mode revealed by the crystal structure of the kinase p38alpha with the MAPK binding domain of the phosphatase MKP5.
22245064 DUSPs 10 and 16 are positive regulators of activation, apparently acting by modulating cross-talk between the p38 and ERK pathways.
More...

AA Sequence

MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSANPGSNSHPPVIATTVVSLKAANLTYMPSSSGSARS      1 - 70
LNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGT     71 - 140
PKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKI    141 - 210
TVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNH    211 - 280
ENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGY    281 - 350
VINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI    351 - 420
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV            421 - 482
//

Text Mined References (37)

PMID Year Title
25973098 2015 Polymorphisms in the DUSP10 gene are associated with sex-specific colorectal cancer risk in a Han population.
25772234 2016 DUSP10 regulates intestinal epithelial cell growth and colorectal tumorigenesis.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
24975273 2014 Changes in vitamin D target gene expression in adipose tissue monitor the vitamin D response of human individuals.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
23993976 2013 Polycyclic aromatic hydrocarbon (PAH)-mediated upregulation of hepatic microRNA-181 family promotes cancer cell migration by targeting MAPK phosphatase-5, regulating the activation of p38 MAPK.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23872954 2014 DUSP10 gene polymorphism and risk of colorectal cancer in the Han Chinese population.
23233447 2013 A high-throughput assay for phosphoprotein-specific phosphatase activity in cellular extracts.
More...