Property Summary

NCBI Gene PubMed Count 82
PubMed Score 762.61
PubTator Score 439.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 2.200 3.5e-04
Astrocytoma, Pilocytic 1.100 1.8e-07
atypical teratoid / rhabdoid tumor 1.200 1.2e-04
esophageal adenocarcinoma -1.200 1.8e-02
glioblastoma 1.300 1.9e-04
invasive ductal carcinoma -1.500 4.0e-03

Gene RIF (50)

AA Sequence

MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAE      1 - 70
RVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYR     71 - 140
DDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQ    141 - 210
EFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDN    211 - 280
QRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPP    281 - 350
SPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL    351 - 420
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSE    421 - 490
FDEDDWSD                                                                  491 - 498
//

Text Mined References (88)

PMID Year Title