Property Summary

NCBI Gene PubMed Count 78
Grant Count 237
R01 Count 129
Funding $58,038,499.85
PubMed Score 683.71
PubTator Score 439.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -1.200 0.018
glioblastoma 1.300 0.000
astrocytoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
pilocytic astrocytoma 1.100 0.000
invasive ductal carcinoma -1.500 0.004

Synonym

Accession Q9Y6W5 B4DZN0 O60794 Q9UDY7 WASP family protein member 2
Symbols IMD2
SCAR2
WASF4
WAVE2
dJ393P12.2

Gene

PDB

2A40  

Gene RIF (48)

PMID Text
26490115 the MCP1-induced cortactin phosphorylation is dependent on PLCb3-mediated PKC activation, and siRNA-mediated down-regulation of either of these molecules prevents cortactin interaction with WAVE2
26018170 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
26018170 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
26018170 HIV-1 VLP production/release from Jurkat T lymphocytes requires an intact RAC1-WASF2-BAIAP2-ARP3 pathway as demonstrated by siRNA knockdown experiments
25745180 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
25527710 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
25342748 WASp and WAVE2 differ in their dynamics and their associated proteins
24778020 WAVE2 is down-regulated in gastric cancer
24469447 Cortactin has a role as a scaffold for Arp2/3 and WAVE2 at the epithelial zonula adherens
24415754 these results suggest that Arp2/3 and the upstream regulator, WAVE2, are essential co-factors hijacked by HIV for intracellular migration, and may serve as novel targets to prevent HIV transmission.
More...

AA Sequence

MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAE      1 - 70
RVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYR     71 - 140
DDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQ    141 - 210
EFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDN    211 - 280
QRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPP    281 - 350
SPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL    351 - 420
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSE    421 - 490
FDEDDWSD                                                                  491 - 498
//

Text Mined References (84)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26490115 2015 PLC?3 mediates cortactin interaction with WAVE2 in MCP1-induced actin polymerization and cell migration.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25342748 2014 WASp family verprolin-homologous protein-2 (WAVE2) and Wiskott-Aldrich syndrome protein (WASp) engage in distinct downstream signaling interactions at the T cell antigen receptor site.
25121749 2014 HCMV pUL135 remodels the actin cytoskeleton to impair immune recognition of infected cells.
24778020 2014 Down-regulation of WAVE2, WASP family verprolin-homologous protein 2, in gastric cancer indicates lymph node metastasis and cell migration.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24469447 2014 Cortactin scaffolds Arp2/3 and WAVE2 at the epithelial zonula adherens.
24415754 2014 HIV-1 triggers WAVE2 phosphorylation in primary CD4 T cells and macrophages, mediating Arp2/3-dependent nuclear migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...