Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
Funding $55,328.5
PubMed Score 29.43
PubTator Score 12.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.333 0.000
malignant mesothelioma 1.100 0.000
osteosarcoma 1.909 0.000
group 3 medulloblastoma 1.500 0.005
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer -1.200 0.003

Synonym

Accession Q9Y6W3
Symbols PALBH
CALPAIN7

Gene

PDB

2QFE  

Gene RIF (5)

PMID Text
24953135 The proteolytic activity of CAPN7 is important for the acceleration of EGFR degradation via the endosomal sorting pathway.
23855590 Data indicate that CAPN 7 promotes endometrial stromal cell (hESC) migration and invasion by increasing the activity of MMP-2 via an increased ratio of MMP-2 to TIMP-2.
23497113 Mutational analysis of calpain-7 reveals the importance of not only the N-terminal microtubule-interacting and trafficking domains but also the C-terminal C2 domain-like domains for proteolytic activity.
21616915 The detected enhancement of autolysis of mGFP-fused calpain-7 by coexpression with CHMP1B and observed further activation by additional coexpression of IST1 in HEK293T cells.
20849418 Results demonstrate that human calpain 7 is proteolytically active, and imply that calpain 7 is activated by ESCRT-III-related protein IST1.

AA Sequence

MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSA      1 - 70
VQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLCLKTSYETADKVLQNKLKQLA     71 - 140
RQALDRAEALSEPLTKPVGKISSTSVKPKPPPVRAHFPLGANPFLERPQSFISPQSCDAQGQRYTAEEIE    141 - 210
VLRTTSKINGIEYVPFMNVDLRERFAYPMPFCDRWGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSF    211 - 280
SIKQTIVSDCSFVASLAISAAYERRFNKKLITGIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQ    281 - 350
LPVDHKGELLCSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDSQTFSKD    351 - 420
NSFRMLYQRFHKGDVLITASTGMMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPWSHLRWKGRYS    421 - 490
ENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVIYLSWNPGLFKESTCIHSTWDAKQGPV    491 - 560
KDAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFANNREFITMVVYKTDGKKVYYPADPPPYIDG    561 - 630
IRINSPHYLTKIKLTTPGTHTFTLVVSQYEKQNTIHYTVRVYSACSFTFSKIPSPYTLSKRINGKWSGQS    631 - 700
AGGCGNFQETHKNNPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFC    701 - 770
YLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ                               771 - 813
//

Text Mined References (16)

PMID Year Title
24953135 2014 Involvement of calpain-7 in epidermal growth factor receptor degradation via the endosomal sorting pathway.
23855590 2013 CAPN 7 promotes the migration and invasion of human endometrial stromal cell by regulating matrix metalloproteinase 2 activity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23497113 2013 Analysis of limited proteolytic activity of calpain-7 using non-physiological substrates in mammalian cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21616915 2011 Calpain-7 binds to CHMP1B at its second ?-helical region and forms a ternary complex with IST1.
20849418 2010 Autolytic activity of human calpain 7 is enhanced by ESCRT-III-related protein IST1 through MIT-MIM interaction.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...